From 4dc860c019926ce931eaf661968828a1fe3da2d1 Mon Sep 17 00:00:00 2001 From: Andrej730 Date: Sun, 16 Oct 2022 13:32:22 +0600 Subject: [PATCH] Added IFC v4.0 json schema and added docs API for working with schemas The schema for IFC4 the same as it was for IFC2x3. Properties schema for IFC4 includes both quantity and propety sets. Also cleaned up entities description for IFC2x3 from HTML code and IFC tags. --- .../ifcopenshell/util/doc.py | 410 +- .../util/schema/ifc2x3_entities.json | 1246 +- .../util/schema/ifc2x3_properties.json | 8 +- .../ifc2x3_property_sets_site_domains.json | 319 + .../util/schema/ifc4_entities.json | 6158 +++++++++ .../util/schema/ifc4_properties.json | 10976 ++++++++++++++++ .../ifc4_property_sets_site_domains.json | 515 + 7 files changed, 18975 insertions(+), 657 deletions(-) create mode 100644 src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_property_sets_site_domains.json create mode 100644 src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_entities.json create mode 100644 src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_properties.json create mode 100644 src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_property_sets_site_domains.json diff --git a/src/ifcopenshell-python/ifcopenshell/util/doc.py b/src/ifcopenshell-python/ifcopenshell/util/doc.py index 95283181f5..218ff0f2c1 100644 --- a/src/ifcopenshell-python/ifcopenshell/util/doc.py +++ b/src/ifcopenshell-python/ifcopenshell/util/doc.py @@ -19,23 +19,86 @@ import glob from pathlib import Path import json +from pprint import pprint import urllib.parse +import warnings + from markdown import markdown from bs4 import BeautifulSoup -from pprint import pprint +from bs4 import MarkupResemblesLocatorWarning import requests -DOCS_LOCATION = 'Ifc2.3.0.1' +IFC2x3_DOCS_LOCATION = 'Ifc2.3.0.1' +IFC4_DOCS_LOCATION = 'Ifc4.0.2.1' + + +SCHEMA_FILES = { + 'IFC2X3': { + 'entities': Path('schema/ifc2x3_entities.json'), + 'properties': Path('schema/ifc2x3_properties.json') + }, + 'IFC4': { + 'entities': Path('schema/ifc4_entities.json'), + 'properties': Path('schema/ifc4_properties.json') + } +} + +class DocAPI: + def __init__(self): + self.doc_database = {ifc_version: dict() for ifc_version in SCHEMA_FILES} + files_missing = False + for ifc_version in SCHEMA_FILES: + for data_type in SCHEMA_FILES[ifc_version]: + schema_path = SCHEMA_FILES[ifc_version][data_type] + if not schema_path.is_file(): + print(f"Schema file {schema_path} wasn't found.") + files_missing = True + continue + + with open(schema_path, 'r') as fi: + self.doc_database[ifc_version][data_type] = json.load(fi) + if files_missing: + raise Exception( + 'Some schema files are missing - they contain neccessary data for DocAPI to work. \n' + 'Make sure those files are present. To generate them you can run DocExtractor extract functions \n' + 'but it will require corresponding Ifc docs to be in the same directory as the script.' + ) + + def check_version_name(self, version_name): + if version_name not in self.doc_database: + raise Exception( + f'Version: {version_name} is not supported. ' + f'Supported version: {", ".join(self.doc_database.keys())}') + return version_name + + def get_entity_doc(self, version, entity): + version = self.check_version_name(version) + return self.doc_database[version]['entities'][entity] + + def get_attribute_doc(self, version, entity, attribute): + version = self.check_version_name(version) + return self.doc_database[version]['entities'][entity]['attributes'][attribute] + + def get_property_set_doc(self, version, pset): + version = self.check_version_name(version) + return self.doc_database[version]['properties'][pset] + + def get_property_doc(self, version, pset, prop): + version = self.check_version_name(version) + return self.doc_database[version]['properties'][pset]['properties'][prop] class DocExtractor: def extract_ifc2x3(self): - parse_data_location = Path(DOCS_LOCATION) + print('Parsing data for Ifc2.3.0.1') + parse_data_location = Path(IFC2x3_DOCS_LOCATION) if not parse_data_location.is_dir(): raise Exception( f'Docs for IFC 2.3.0.1 expected to be in folder "{parse_data_location.resolve()}\\"\n' 'For doc extraction please either setup docs as described above \n' - 'or change DOCS_LOCATION in doc.py accordingly.' + 'or change IFC2x3_DOCS_LOCATION in doc.py accordingly. \n' + 'You can download docs from the repository: \n' + 'https://github.com/buildingSMART/IFC/tree/Ifc2.3.0.1' ) # need to parse actual domains from the website @@ -43,11 +106,11 @@ class DocExtractor: # probably due domains on the website being from 4_0 # example (property set / github domain / website domain): # Pset_AirTerminalBoxPHistory IfcControlExtension IfcHvacDomain - self.extract_ifc2x3_property_sets_domains() + self.extract_ifc2x3_property_sets_site_domains() self.extract_ifc2x3_entities() self.extract_ifc2x3_property_sets() - def extract_ifc2x3_property_sets_domains(self): + def extract_ifc2x3_property_sets_site_domains(self): property_sets_domains = dict() r = requests.get('https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/psd/psd_index.htm') html = BeautifulSoup(r.content, features='lxml') @@ -56,7 +119,7 @@ class DocExtractor: property_sets_domains[pset] = domain # export property sets data - with open('schema/ifc2x3_property_sets_domains.json', 'w', encoding='utf-8') as fo: + with open('schema/ifc2x3_property_sets_site_domains.json', 'w', encoding='utf-8') as fo: print(f'{len(property_sets_domains)} property sets domains were parsed from the website') json.dump( property_sets_domains, fo, @@ -67,7 +130,8 @@ class DocExtractor: entities_dict = dict() # search - entities_paths = [filepath for filepath in glob.iglob(f'{DOCS_LOCATION}/Sections/**/Entities', recursive=True)] + entities_paths = [filepath + for filepath in glob.iglob(f'{IFC2x3_DOCS_LOCATION}/Sections/**/Entities', recursive=True)] for parse_folder_path in entities_paths: for entity_path in glob.iglob(f'{parse_folder_path}/**/'): entity_path = Path(entity_path) @@ -82,24 +146,44 @@ class DocExtractor: with open(md_path, 'r', encoding='utf-8-sig') as fi: # convert markdown to html for easier parsing html = markdown(fi.read()) - description = BeautifulSoup(html, features="lxml").find('p').text - description = description.replace('\n', ' ') - description = description.replace('\u00a0', ' ') + entity_description = BeautifulSoup(html, features="lxml").find('p').text + entity_description = entity_description.replace('\n', ' ') + entity_description = entity_description.replace('\u00a0', ' ') with open(xml_path, 'r', encoding='utf-8') as fi: bs_tree = BeautifulSoup(fi.read(), features='lxml') entity_attrs = dict() - for html_attr in bs_tree.find_all('docattribute'): + # temporarily disable MarkupResemblesLocatorWarning + # because BeautifulSoup wrongly assume we confused + # html code for filepath and gives warnings + with warnings.catch_warnings(): + warnings.simplefilter('ignore', category=MarkupResemblesLocatorWarning) - description = html_attr.text.strip() - description = description.replace('\n', ' ') - description = description.replace('\u00a0', ' ') - entity_attrs[html_attr['name']] = description + for html_attr in bs_tree.find_all('docattribute'): + html_description = BeautifulSoup(html_attr.text, features='lxml') + attr_description = html_description.get_text() + + attr_description = attr_description.replace('\n', ' ') + attr_description = attr_description.replace('\u00a0', ' ') + attr_description = attr_description.replace('&npsp;', ' ') + + # discard part of the description with changelog + # Example: + # https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcannotationfillarea.htm + attr_description = attr_description.split('IFC2x Edition 3 CHANGE', 1)[0] + attr_description = attr_description.split('IFC2x Edition 2 Addendum 2 CHANGE', 1)[0] + attr_description = attr_description.split('IFC2x2 Addendum 1 change', 1)[0] + attr_description = attr_description.split('IFC2x PLATFORM CHANGE', 1)[0] + attr_description = attr_description.split('IFC2x3 CHANGE', 1)[0] + attr_description = attr_description.split('IFC2x Edition3 CHANGE', 1)[0] + + attr_description = attr_description.strip().rstrip('>').strip() + entity_attrs[html_attr['name']] = attr_description if entity_attrs: entities_dict[entity_name]['attributes'] = entity_attrs - entities_dict[entity_name]['description'] = description + entities_dict[entity_name]['description'] = entity_description spec_url = 'https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/' \ f'{md_path.parents[2].name.lower()}/lexical/{entity_name.lower()}.htm' entities_dict[entity_name]['spec_url'] = spec_url @@ -118,10 +202,11 @@ class DocExtractor: property_sets_spec_urls = dict() # extract lists of properties and theirs references for each property set - parsed_paths = [filepath for filepath in glob.iglob(f'{DOCS_LOCATION}/Sections/**/PropertySets', recursive=True)] + parsed_paths = [filepath + for filepath in glob.iglob(f'{IFC2x3_DOCS_LOCATION}/Sections/**/PropertySets', recursive=True)] # prepare property sets domains from the website we extracted earlier - with open('schema/ifc2x3_property_sets_domains.json', 'r') as fi: + with open('schema/ifc2x3_property_sets_site_domains.json', 'r') as fi: property_sets_site_domains = json.load(fi) for parse_folder_path in parsed_paths: @@ -133,21 +218,21 @@ class DocExtractor: xml_path = property_set_path / 'DocPropertySet.xml' with open(xml_path, 'r', encoding='utf-8') as fi: bs_tree = BeautifulSoup(fi.read(), features='lxml') - entity_attrs = dict() for html_attr in bs_tree.find_all('docproperty'): property_references.append(html_attr['href']) property_sets_references[property_set_name] = property_references property_set_domain = property_sets_site_domains[property_set_name] - spec_url = f'https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/psd/{property_set_domain}/{property_set_name}.xml' + spec_url = 'https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML' \ + f'/psd/{property_set_domain}/{property_set_name}.xml' property_sets_spec_urls[property_set_name] = spec_url # setup references look up tables to convert property hrefs to actual data paths references_paths_lookup = dict() - glob_query = f'{DOCS_LOCATION}/Properties/*/*' + glob_query = f'{IFC2x3_DOCS_LOCATION}/Properties/*/*' for parsed_path in [filepath for filepath in glob.iglob(glob_query, recursive=False)]: parsed_path = Path(parsed_path) - # all references omit "$" character, I've checked + # all references omit "$" character, I've checked it on 2_3 # need to check it if moving to next IFC version property_reference = parsed_path.name.replace('$', '') references_paths_lookup[property_reference] = parsed_path @@ -164,7 +249,6 @@ class DocExtractor: with open(xml_path, 'r', encoding='utf-8') as fi: bs_tree = BeautifulSoup(fi.read(), features='lxml') - entity_attrs = dict() tags = bs_tree.find_all('docproperty') # check for child properties - if they are present parse their data recursively @@ -188,9 +272,8 @@ class DocExtractor: if not md_path.is_file(): - print('WARNING. Property is missing documentation.md, description will be set to empty. ' - f'Url: {github_xml_url}') - description = '' + print(f'WARNING. Property {property_name} is missing documentation.md, ' + f'property will be left without description. Url: {github_xml_url}') else: with open(md_path, 'r', encoding='utf-8-sig') as fi: # convert markdown to html for easier parsing @@ -198,7 +281,7 @@ class DocExtractor: description = BeautifulSoup(html, features="lxml").find('p').text description = description.replace('\n', ' ') description = description.replace('\u00a0', ' ') - property_dict['description'] = description + property_dict['description'] = description return (property_name, property_dict) @@ -222,9 +305,280 @@ class DocExtractor: sort_keys=True, indent=4 ) + def extract_ifc4(self): + print('Parsing data for Ifc4.0.2.1') + parse_data_location = Path(IFC4_DOCS_LOCATION) + if not parse_data_location.is_dir(): + raise Exception( + f'Docs for Ifc4.0.2.1 expected to be in folder "{parse_data_location.resolve()}\\"\n' + 'For doc extraction please either setup docs as described above \n' + 'or change IFC4_DOCS_LOCATION in doc.py accordingly.' + 'You can download docs from the repository: \n' + 'https://github.com/buildingSMART/IFC/tree/Ifc4.0.2.1' + ) + + # actually domains in Ifc 4.0 are consistent between website and docs + # BUT there are two property sets that site is missing and therefore they won't have spec_url + # because of them I left the site parsing too + # missed property sets: + # Pset_BuildingElementCommon Pset_ElementCommon + self.extract_ifc4_property_sets_site_domains() + self.extract_ifc4_entities() + self.extract_ifc4_property_sets() + + def extract_ifc4_property_sets_site_domains(self): + property_sets_domains = dict() + with requests.get( + 'https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1' + '/HTML/annex/annex-b/alphabeticalorder_psets.htm') as r: + html = BeautifulSoup(r.content, features='lxml') + for a in html.find_all('a', {'class': 'listing-link'}): + href_split = a['href'].split('/') + domain = href_split[3] + pset = href_split[5].removesuffix('.htm') + property_sets_domains[pset] = domain + + with requests.get( + 'https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/' + '/HTML/annex/annex-b/alphabeticalorder_qsets.htm') as r: + html = BeautifulSoup(r.content, features='lxml') + for a in html.find_all('a', {'class': 'listing-link'}): + href_split = a['href'].split('/') + domain = href_split[3] + pset = href_split[5].removesuffix('.htm') + property_sets_domains[pset] = domain + + # export property sets data + with open('schema/ifc4_property_sets_site_domains.json', 'w', encoding='utf-8') as fo: + print(f'{len(property_sets_domains)} property sets domains were parsed from the website') + json.dump( + property_sets_domains, fo, + sort_keys=True, indent=4 + ) + + def extract_ifc4_entities(self): + entities_dict = dict() + + # search + entities_paths = [filepath for filepath in glob.iglob(f'{IFC4_DOCS_LOCATION}/Sections/**/Entities', recursive=True)] + for parse_folder_path in entities_paths: + for entity_path in glob.iglob(f'{parse_folder_path}/**/'): + entity_path = Path(entity_path) + entity_name = entity_path.stem + entities_dict[entity_name] = dict() + + # utf-8-sig because of \ufeff occcurs - meaning it's utf bom encoded + md_path = entity_path / 'Documentation.md' + xml_path = entity_path / 'DocEntity.xml' + github_md_url = f'https://github.com/buildingSMART/IFC/blob/{urllib.parse.quote(str(md_path.as_posix()))}' + + with open(md_path, 'r', encoding='utf-8-sig') as fi: + # convert markdown to html for easier parsing + html = markdown(fi.read()) + entity_description = BeautifulSoup(html, features="lxml").find('p').text + entity_description = entity_description.replace('\n', ' ') + entity_description = entity_description.replace('\u00a0', ' ') + entity_description = entity_description.replace('{ .extDef}', '') + entity_description = entity_description.strip() + + with open(xml_path, 'r', encoding='utf-8') as fi: + bs_tree = BeautifulSoup(fi.read(), features='lxml') + entity_attrs = dict() + # temporarily disable MarkupResemblesLocatorWarning + # because BeautifulSoup wrongly assume we confused + # html code for filepath and gives warnings + with warnings.catch_warnings(): + warnings.simplefilter('ignore', category=MarkupResemblesLocatorWarning) + for html_attr in bs_tree.find_all('docattribute'): + html_description = BeautifulSoup(html_attr.text, features='lxml') + attr_description = html_description.get_text() + attr_description = attr_description.replace('\n', ' ') + attr_description = attr_description.replace('\u00a0', ' ') + + # discard part of the description with changelog, notes and examples etc. + # Those notes actually can be useful but we'll need a way to reformat them + # Example: + # https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrelconnectspathelements.htm + attr_description = attr_description.split('{ .change-ifc', 1)[0] + attr_description = attr_description.split('{ .note', 1)[0] + attr_description = attr_description.split('{ .examples', 1)[0] + attr_description = attr_description.split('{ .deprecated', 1)[0] + attr_description = attr_description.split('{ .history', 1)[0] + + attr_description = attr_description.strip() + entity_attrs[html_attr['name']] = attr_description + + if entity_attrs: + entities_dict[entity_name]['attributes'] = entity_attrs + + entities_dict[entity_name]['description'] = entity_description + spec_url = 'https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/' \ + f'{md_path.parents[2].name.lower()}/lexical/{entity_name.lower()}.htm' + entities_dict[entity_name]['spec_url'] = spec_url + # entities_dict[entity_name]['github_url'] = github_md_url + + # export entities data + with open('schema/ifc4_entities.json', 'w', encoding='utf-8') as fo: + print(f'{len(entities_dict)} entities parsed') + json.dump( + entities_dict, fo, + sort_keys=True, indent=4 + ) + + def extract_ifc4_property_sets(self): + # function parses both property and quantity sets + property_sets_dict = dict() + property_sets_references = dict() + property_sets_spec_urls = dict() + + # extract lists of properties and theirs references for each property set + parsed_paths = [filepath for filepath in glob.iglob(f'{IFC4_DOCS_LOCATION}/Sections/**/PropertySets', recursive=True)] + parsed_paths += [filepath for filepath in glob.iglob(f'{IFC4_DOCS_LOCATION}/Sections/**/QuantitySets', recursive=True)] + + # prepare property sets domains from the website we extracted earlier + with open('schema/ifc4_property_sets_site_domains.json', 'r') as fi: + property_sets_site_domains = json.load(fi) + + psets_test = set() + for parse_folder_path in parsed_paths: + for property_set_path in glob.iglob(f'{parse_folder_path}/**/'): + property_set_path = Path(property_set_path) + property_set_name = property_set_path.stem + + property_references = list() + property_quantity = property_set_path.parents[0].name == 'QuantitySets' + xml_path = property_set_path / ('DocQuantitySet.xml' if property_quantity else 'DocPropertySet.xml') + + with open(xml_path, 'r', encoding='utf-8') as fi: + bs_tree = BeautifulSoup(fi.read(), features='lxml') + for html_attr in bs_tree.find_all('docquantity' if property_quantity else 'docproperty'): + property_references.append(html_attr['href']) + + property_sets_references[property_set_name] = property_references + + if property_set_name.lower() not in property_sets_site_domains: + print(f"WARNING. {property_set_name} was not found on the spec website, " + "this property set won't have any spec_url in schema.") + else: + property_set_domain = property_sets_site_domains.get(property_set_name.lower(), '') + spec_url = 'https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML' \ + f'/schema/{property_set_domain}' \ + f'/{"qset" if property_quantity else "pset"}' \ + f'/{property_set_name.lower()}.htm' + property_sets_spec_urls[property_set_name] = spec_url + + + # setup references look up tables to convert property hrefs to actual data paths + references_paths_lookup = dict() + parsed_paths = [filepath + for filepath in glob.iglob(f'{IFC4_DOCS_LOCATION}/Properties/*/*', recursive=False)] + parsed_paths += [filepath + for filepath in glob.iglob(f'{IFC4_DOCS_LOCATION}/Quantities/*/*', recursive=False)] + for parsed_path in parsed_paths: + parsed_path = Path(parsed_path) + # all references omit "$" character, I've checked it on 4_0 + # need to check it if moving to next IFC version + # btw no reason to check if all references were used in properties + # because there are also child properties + property_reference = parsed_path.name.replace('$', '') + references_paths_lookup[property_reference] = parsed_path + + # setup a function because we'll need to check child properties recusively + def get_property_info_by_href(href): + property_dict = dict() + property_path = references_paths_lookup[href] + + property_quantity = property_path.parents[1].name == 'Quantities' + + md_path = property_path / 'Documentation.md' + xml_path = property_path / ('DocQuantity.xml' if property_quantity else 'DocProperty.xml') + github_md_url = f'https://github.com/buildingSMART/IFC/blob/{urllib.parse.quote(str(md_path.as_posix()))}' + github_xml_url = f'https://github.com/buildingSMART/IFC/blob/{urllib.parse.quote(str(xml_path.as_posix()))}' + + with open(xml_path, 'r', encoding='utf-8') as fi: + bs_tree = BeautifulSoup(fi.read(), features='lxml') + tags = bs_tree.find_all('docquantity' if property_quantity else 'docproperty') + + # check for child properties - if they are present parse their data recursively + elements_tag = bs_tree.find('elements') + if elements_tag is not None: + child_tags = elements_tag.find_all('docquantity' if property_quantity else 'docproperty') + child_tags_dict = dict() + + for child_tag in child_tags: + child_tag_href = child_tag['href'] + child_tag_name, child_tag_dict = get_property_info_by_href(child_tag_href) + child_tags_dict[child_tag_name] = child_tag_dict + tags.remove(child_tag) + property_dict['children'] = child_tags_dict + print(f'Child nodes found inside property xml. Url: {github_xml_url}') + + if len(tags) != 1: + print(f'WARNING. Found more properties inside property xml, ' + f'only first one were parsed (number of properties: {len(tags)}). Url: {github_xml_url}.') + property_name = tags[0]['name'] + + if not md_path.is_file(): + print(f'WARNING. Property {property_name} is missing documentation.md, property will be left without description. ' + f'Url: {github_xml_url}') + else: + with open(md_path, 'r', encoding='utf-8-sig') as fi: + # convert markdown to html for easier parsing + html = markdown(fi.read()) + description = BeautifulSoup(html, features="lxml").find('p').text + description = description.replace('\n', ' ') + description = description.replace('\u00a0', ' ') + property_dict['description'] = description + return (property_name, property_dict) + + # lookup each property reference and save it's name and description + for property_set_name in property_sets_references: + properties_dict = dict() + for property_reference in property_sets_references[property_set_name]: + property_name, property_dict = get_property_info_by_href(property_reference) + properties_dict[property_name] = property_dict + property_sets_dict[property_set_name] = { + 'properties': properties_dict + } + if property_set_name in property_sets_spec_urls: + spec_url = property_sets_spec_urls[property_set_name] + property_sets_dict[property_set_name]['spec_url'] = spec_url + + + # export property sets data + with open('schema/ifc4_properties.json', 'w', encoding='utf-8') as fo: + print(f'{len(property_sets_dict)} property sets parsed') + json.dump( + property_sets_dict, fo, + sort_keys=True, indent=4 + ) + +def run_doc_api_examples(): + query = DocAPI() + print('Entities:') + print(query.get_entity_doc('IFC2X3', 'IfcActionRequest')) + print(query.get_entity_doc('IFC4', 'IfcActionRequest')) + + print('Entity attributes:') + print(query.get_attribute_doc('IFC2X3', 'IfcActionRequest', 'RequestID')) + print(query.get_attribute_doc('IFC4', 'IfcActionRequest', 'PredefinedType')) + + print('Propety sets:') + print(query.get_property_set_doc('IFC2X3', 'Pset_ZoneCommon')) + print(query.get_property_set_doc('IFC4', 'Pset_ZoneCommon')) + + print('Propety sets attributes:') + print(query.get_property_doc('IFC2X3', 'Pset_ZoneCommon', 'Category')) + print(query.get_property_doc('IFC4', 'Pset_ZoneCommon', 'NetPlannedArea')) + if __name__ == '__main__': extractor = DocExtractor() extractor.extract_ifc2x3() + extractor.extract_ifc4() + + # run_doc_api_examples() + + diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_entities.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_entities.json index 5bfe331c9e..fbe805ae8e 100644 --- a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_entities.json +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_entities.json @@ -7,7 +7,7 @@ "attributes": { "RequestID": "A unique identifier assigned to the request on receipt." }, - "description": "A unique identifier assigned to the request on receipt.", + "description": "An IfcActionRequest is a request for an action to fulfill a need.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcfacilitiesmgmtdomain/lexical/ifcactionrequest.htm" }, "IfcActor": { @@ -15,7 +15,7 @@ "IsActingUpon": "Reference to the relationship that associates the actor to an object.", "TheActor": "Information about the actor." }, - "description": "Reference to the relationship that associates the actor to an object.", + "description": "The IfcActor defines all actors or human agents involved in a project during its full life cycle. It facilitates the use of person and organization definitions in the resource part of the IFC object model.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcactor.htm" }, "IfcActorRole": { @@ -24,14 +24,14 @@ "Role": "The name of the role played by an actor. If the Role has value USERDEFINED, then the user defined role shall be provided as a value of the attribute UserDefinedRole.", "UserDefinedRole": "Allows for specification of user defined roles beyond the enumeration values provided by Role attribute of type IfcRoleEnum. When a value is provided for attribute UserDefinedRole in parallel the attribute Role shall have enumeration value USERDEFINED." }, - "description": "A textual description relating the nature of the role played by an actor.", + "description": "A role which is performed by an actor, either a person, an organization or a person related to an organization.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcactorrole.htm" }, "IfcActuatorType": { "attributes": { "PredefinedType": "Identifies the predefined types of actuator from which the type required may be set." }, - "description": "Identifies the predefined types of actuator from which the type required may be set.", + "description": "An IfcActuatorType defines a particular type of actuating device that is typically used in a control system such as a building automation control system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcbuildingcontrolsdomain/lexical/ifcactuatortype.htm" }, "IfcAddress": { @@ -42,35 +42,35 @@ "Purpose": "Identifies the logical location of the address.", "UserDefinedPurpose": "Allows for specification of user specific purpose of the address beyond the enumeration values provided by Purpose attribute of type IfcAddressTypeEnum. When a value is provided for attribute UserDefinedPurpose, in parallel the attribute Purpose shall have enumeration value USERDEFINED." }, - "description": "The inverse relationship to Organization to whom address is associated.", + "description": "An abstract entity type for various kinds of postal and telecom addresses.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcaddress.htm" }, "IfcAirTerminalBoxType": { "attributes": { "PredefinedType": "The air terminal box type." }, - "description": "The air terminal box type.", + "description": "The element type IfcAirTerminalBoxType defines a list of commonly shared property set definitions of an air termainal box and an optional set of product representations. It is used to define an air terminal box specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcairterminalboxtype.htm" }, "IfcAirTerminalType": { "attributes": { "PredefinedType": "" }, - "description": "", + "description": "The element type IfcAirTerminalType defines a list of commonly shared property set definitions of an air terminal and an optional set of product representations. It is used to define an air terminal specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcairterminaltype.htm" }, "IfcAirToAirHeatRecoveryType": { "attributes": { "PredefinedType": "Defines the type of air to air heat recovery device." }, - "description": "Defines the type of air to air heat recovery device.", + "description": "The element type IfcAirToAirHeatRecoveryType defines a list of commonly shared property set definitions of an air-to-air heat recovery device and an optional set of product representations. It is used to define an air-to-air heat recovery device specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcairtoairheatrecoverytype.htm" }, "IfcAlarmType": { "attributes": { "PredefinedType": "Identifies the predefined types of alarm from which the type required may be set." }, - "description": "Identifies the predefined types of alarm from which the type required may be set.", + "description": "The IfcAlarmType defines a device that signals the existence of a condition or situation that is outside the boundaries of normal expectation or that activates such a device.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcbuildingcontrolsdomain/lexical/ifcalarmtype.htm" }, "IfcAngularDimension": { @@ -81,7 +81,7 @@ "attributes": { "ContainedInStructure": "Relationship to a spatial structure element, to which the associate is primarily associated." }, - "description": "Relationship to a spatial structure element, to which the associate is primarily associated.", + "description": "An annotation is a graphical representation within the geometric (and spatial) context of a project, that adds a note or meaning to the objects which constitutes the project model. Annotations include additional line drawings, text, dimensioning, hatching and other forms of graphical notes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcannotation.htm" }, "IfcAnnotationCurveOccurrence": { @@ -90,18 +90,18 @@ }, "IfcAnnotationFillArea": { "attributes": { - "InnerBoundaries": "A set of inner curves that define the inner boundaries of the fill area. The areas defined by the inner boundaries are excluded from applying the fill area style. > IFC2x Edition 3 CHANGE  The two new attributes OuterBoundary and InnerBoundaries replace the old single attribute Boundaries. ", - "OuterBoundary": "A closed curve that defines the outer boundary of the fill area. The areas defined by the outer boundary (minus potentially defined inner boundaries) is filled by the fill area style. > IFC2x Edition 3 CHANGE  The two new attributes OuterBoundary and InnerBoundaries replace the old single attribute Boundaries. " + "InnerBoundaries": "A set of inner curves that define the inner boundaries of the fill area. The areas defined by the inner boundaries are excluded from applying the fill area style.", + "OuterBoundary": "A closed curve that defines the outer boundary of the fill area. The areas defined by the outer boundary (minus potentially defined inner boundaries) is filled by the fill area style." }, - "description": "A set of inner curves that define the inner boundaries of the fill area. The areas defined by the inner boundaries are excluded from applying the fill area style. > IFC2x Edition 3 CHANGE  The two new attributes OuterBoundary and InnerBoundaries replace the old single attribute Boundaries. ", + "description": "Definition from ISO/CD 10303-46:1992: An annotation fill area is a set of curves that may be filled with hatching, colour or tiling. The annotation fill are is described by boundaries which consist of non-intersecting, non-self-intersecting closed curves. These curves form the boundary of planar areas to be filled according to the style for the annotation fill area.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcannotationfillarea.htm" }, "IfcAnnotationFillAreaOccurrence": { "attributes": { - "FillStyleTarget": "The point that specifies the starting location for the fill area style assigned to the annotation fill area occurrence. Depending on the attribute _GlobalOrLocal_ the point is either given within the world coordinate system of the project or within the object coordinate system of the element or annotation. If the _FillStyleTarget_ is not given, it defaults to 0.,0. > IFC2x Edition 3 CHANGE  The attribute has been made OPTIONAL. ", - "GlobalOrLocal": "The coordinate system in which the _FillStyleTarget_ point is given. Depending on the attribute _GlobalOrLocal_ the point is either given within the world coordinate system of the project or within the object coordinate system of the element or annotation. If not given, the hatch style is directly applied to the parameterization of the geometric representation item, e.g. to the surface coordinate sytem, defined by the surface normal. > IFC2x Edition 3 CHANGE  The attribute has been added. " + "FillStyleTarget": "The point that specifies the starting location for the fill area style assigned to the annotation fill area occurrence. Depending on the attribute _GlobalOrLocal_ the point is either given within the world coordinate system of the project or within the object coordinate system of the element or annotation. If the _FillStyleTarget_ is not given, it defaults to 0.,0.", + "GlobalOrLocal": "The coordinate system in which the _FillStyleTarget_ point is given. Depending on the attribute _GlobalOrLocal_ the point is either given within the world coordinate system of the project or within the object coordinate system of the element or annotation. If not given, the hatch style is directly applied to the parameterization of the geometric representation item, e.g. to the surface coordinate sytem, defined by the surface normal." }, - "description": "The coordinate system in which the _FillStyleTarget_ point is given. Depending on the attribute _GlobalOrLocal_ the point is either given within the world coordinate system of the project or within the object coordinate system of the element or annotation. If not given, the hatch style is directly applied to the parameterization of the geometric representation item, e.g. to the surface coordinate sytem, defined by the surface normal. > IFC2x Edition 3 CHANGE  The attribute has been added. ", + "description": "Definition from ISO/CD 10303-46:1992: An annotation fill area occurrence is a fill area with a style assignment.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcannotationfillareaoccurrence.htm" }, "IfcAnnotationOccurrence": { @@ -113,7 +113,7 @@ "Item": "Geometric representation item, providing the geometric definition of the annotated surface. It is further restricted to be a surface, surface model, or solid model.", "TextureCoordinates": "Texture coordinates, such as a texture map, that are associated with the textures for the surface style. It should only be given, if the _IfcSurfaceStyle_ associated to the _IfcAnnotationSurfaceOccurrence_ contains an _IfcSurfaceStyleWithTextures_." }, - "description": "Texture coordinates, such as a texture map, that are associated with the textures for the surface style. It should only be given, if the _IfcSurfaceStyle_ associated to the _IfcAnnotationSurfaceOccurrence_ contains an _IfcSurfaceStyleWithTextures_.", + "description": "Definition from IAI: An IfcAnnotationSurface is a surface or solid with texture coordinates assigned. It provides the capabilities to assign", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcannotationsurface.htm" }, "IfcAnnotationSurfaceOccurrence": { @@ -135,7 +135,7 @@ "ApplicationIdentifier": "Short identifying name for the application.", "Version": "The version number of this software as specified by the developer of the application." }, - "description": "Short identifying name for the application.", + "description": "IfcApplication holds the information about an IFC compliant application developed by an application developer who is a member of the IAI. The IfcApplication utilizes a short identifying name as provided by the application developer.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcutilityresource/lexical/ifcapplication.htm" }, "IfcAppliedValue": { @@ -150,7 +150,7 @@ "ValueOfComponents": "The total (or subtotal) value of the components within the applied value relationship expressed as a single applied value.", "ValuesReferenced": "Pointer to the IfcReferencesCostDocument relationship, which refer to a document from which the cost value is referenced." }, - "description": "The value of the single applied value which is used by the applied value relationship to express a complex applied value.", + "description": "An IfcAppliedValue is an abstract supertype that specifies the common attributes for cost and environmental values that may be applied to objects within the IFC model.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifcappliedvalue.htm" }, "IfcAppliedValueRelationship": { @@ -161,7 +161,7 @@ "Description": "A description that may apply additional information about an applied value relationship.", "Name": "A name used to identify or qualify the applied value relationship." }, - "description": "A description that may apply additional information about an applied value relationship.", + "description": "An IfcAppliedValueRelationship is a relationship class that enables applied values of cost or environmental impact to be aggregated together as components of another applied value.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifcappliedvaluerelationship.htm" }, "IfcApproval": { @@ -177,7 +177,7 @@ "Name": "A human readable name given to an approval.", "Relates": "The set of relationships by which other approvals are related to this one." }, - "description": "The set of relationships by which other approvals are related to this one.", + "description": "An IfcApproval represents information about approval processes for a plan, a design, a proposal, a change order, etc, in a construction or facilities management project. IfcApproval is referenced by IfcRelAssociatesApproval in IfcControlExtension schema, and thereby can be related to all subtypes of IfcRoot.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcapprovalresource/lexical/ifcapproval.htm" }, "IfcApprovalActorRelationship": { @@ -186,7 +186,7 @@ "Approval": "The approval on which the actor is acting in the role specified in this relationship.", "Role": "The role of the actor w.r.t the approval." }, - "description": "The role of the actor w.r.t the approval.", + "description": "IfcApprovalActorRelationship is used for associating actors to approvals. An actor may be identified as a person or an organization, and may have a specified role in the approval process, e.g. either requesting or giving approval.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcapprovalresource/lexical/ifcapprovalactorrelationship.htm" }, "IfcApprovalPropertyRelationship": { @@ -194,7 +194,7 @@ "Approval": "The approval for the properties selected.", "ApprovedProperties": "Properties approved by the approval." }, - "description": "The approval for the properties selected.", + "description": "IfcApprovalPropertyRelationship is used for associating an approval to properties. A single approval might be given to one or many instances of IfcProperty.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcapprovalresource/lexical/ifcapprovalpropertyrelationship.htm" }, "IfcApprovalRelationship": { @@ -204,28 +204,28 @@ "RelatedApproval": "The approval that relates to another approval", "RelatingApproval": "The approval that other approval is related to." }, - "description": "The human readable name given to the relationship between the approvals.", + "description": "An IfcApprovalRelationship associates two approvals, having e.g. different status or level as approval process or the approved objects evolve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcapprovalresource/lexical/ifcapprovalrelationship.htm" }, "IfcArbitraryClosedProfileDef": { "attributes": { "OuterCurve": "Bounded curve, defining the outer boundaries of the arbitrary profile." }, - "description": "Bounded curve, defining the outer boundaries of the arbitrary profile.", + "description": "Definition from IAI: The closed profile IfcArbitraryClosedProfileDef defines an arbitrary two-dimensional profile for the use within the swept surface geometry, the swept area solid or a sectioned spine. It is given by an outer boundary from which the surface or solid can be constructed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcarbitraryclosedprofiledef.htm" }, "IfcArbitraryOpenProfileDef": { "attributes": { "Curve": "Open bounded curve defining the profile." }, - "description": "Open bounded curve defining the profile.", + "description": "Definition from IAI: The open profile IfcArbitraryOpenProfileDef defines an arbitrary two-dimensional open profile for the use within the swept surface geometry. It is given by an open boundary from with the surface can be constructed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcarbitraryopenprofiledef.htm" }, "IfcArbitraryProfileDefWithVoids": { "attributes": { "InnerCurves": "Set of bounded curves, defining the inner boundaries of the arbitrary profile." }, - "description": "Set of bounded curves, defining the inner boundaries of the arbitrary profile.", + "description": "Definition from IAI: The IfcArbitraryProfileDefWithVoids defines an arbitrary closed two-dimensional profile with holes defined for the use for the swept area solid or a sectioned spine. It is given by an outer boundary and inner boundaries from with the solid the can be constructed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcarbitraryprofiledefwithvoids.htm" }, "IfcAsset": { @@ -240,17 +240,17 @@ "TotalReplacementCost": "The total cost of replacement of the asset.", "User": "The name of the person or organization that 'uses' the asset." }, - "description": "The current value of an asset within the accounting rules and procedures of an organization.", + "description": "An IfcAsset is a uniquely identifiable grouping of elements acting as a single entity that has a financial value", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcasset.htm" }, "IfcAsymmetricIShapeProfileDef": { "attributes": { - "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box.", "TopFlangeFilletRadius": "The fillet between the web and the top flange of the I-shape. If given, the fillet between upper and the lower flanges and the web can be different. If not given, the value of the inherited FilletRadius attribute applies to both, the top and bottom fillet. If the inherited FilletRadius is not given either, no filler is applied.", "TopFlangeThickness": "Flange thickness of the top flange of the I-shape. If given, the upper and the lower flanges can have different thicknesses. If not given, the value of the inherited FlangeThickness attribute applies to both, the top and bottom flange thickness.", "TopFlangeWidth": "Extent of the top flange, defined parallel to the x axis of the position coordinate system." }, - "description": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "Definition from IAI: The IfcAsymmetricIShapeProfileDef defines a section profile that provides the defining parameters of an asymmetric I-shaped section to be used by the swept area solid. The bottom flange is always wider than the top flange. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profiles centre of the gravity bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcasymmetricishapeprofiledef.htm" }, "IfcAxis1Placement": { @@ -258,7 +258,7 @@ "Axis": "The direction of the local Z axis.", "Z": "The normalized direction of the local Z axis. It is either identical with the Axis value, if given, or it defaults to [0.,0.,1.] NVL (IfcNormalise(Axis), IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcDirection([0.0,0.0,1.0]))" }, - "description": "The normalized direction of the local Z axis. It is either identical with the Axis value, if given, or it defaults to [0.,0.,1.] NVL (IfcNormalise(Axis), IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcDirection([0.0,0.0,1.0]))", + "description": "Definition from ISO/CD 10303-42:1992: The direction and location in three dimensional space of a single axis. An axis1_placement is defined in terms of a locating point (inherited from placement supertype) and an axis direction: this is either the direction of axis or defaults to (0.0,0.0,1.0). The actual direction for the axis placement is given by the derived attribute z (Z).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcaxis1placement.htm" }, "IfcAxis2Placement2D": { @@ -266,7 +266,7 @@ "P": "P[1]: The normalized direction of the placement X Axis. This is (1.0,0.0,0.0) if RefDirection is omitted. P[2]: The normalized direction of the placement Y Axis. This is a derived attribute and is orthogonal to P[1]. IfcBuild2Axes(RefDirection)", "RefDirection": "The direction used to determine the direction of the local X Axis." }, - "description": "P[1]: The normalized direction of the placement X Axis. This is (1.0,0.0,0.0) if RefDirection is omitted. P[2]: The normalized direction of the placement Y Axis. This is a derived attribute and is orthogonal to P[1]. IfcBuild2Axes(RefDirection)", + "description": "Definition from ISO/CD 10303-42:1992: The location and orientation in two dimensional space of two mutually perpendicular axes. An axis2_placement_2d is defined in terms of a point, (inherited from the placement supertype), and an axis. It can be used to locate and originate an object in two dimensional space and to define a placement coordinate system. The class includes a point which forms the origin of the placement coordinate system. A direction vector is required to complete the definition of the placement coordinate system. The reference direction defines the placement X axis direction, the placement Y axis is derived from this.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcaxis2placement2d.htm" }, "IfcAxis2Placement3D": { @@ -275,7 +275,7 @@ "P": "The normalized directions of the placement X Axis (P[1]) and the placement Y Axis (P[2]) and the placement Z Axis (P[3]). IfcBuildAxes(Axis, RefDirection)", "RefDirection": "The direction used to determine the direction of the local X Axis. If necessary an adjustment is made to maintain orthogonality to the Axis direction. If Axis and/or RefDirection is omitted, these directions are taken from the geometric coordinate system." }, - "description": "The normalized directions of the placement X Axis (P[1]) and the placement Y Axis (P[2]) and the placement Z Axis (P[3]). IfcBuildAxes(Axis, RefDirection)", + "description": "Definition from ISO/CD 10303-42:1992: The location and orientation in three dimensional space of three mutually perpendicular axes. An axis2_placement_3D is defined in terms of a point (inherited from placement supertype) and two (ideally orthogonal) axes. It can be used to locate and originate an object in three dimensional space and to define a placement coordinate system. The entity includes a point which forms the origin of the placement coordinate system. Two direction vectors are required to complete the definition of the placement coordinate system. The axis is the placement Z axis direction and the ref_direction is an approximation to the placement X axis direction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcaxis2placement3d.htm" }, "IfcBSplineCurve": { @@ -288,7 +288,7 @@ "SelfIntersect": "Indication whether the curve self-intersects or not; it is for information only.", "UpperIndexOnControlPoints": "The upper index on the array of control points; the lower index is 0. This value is derived from the control points list. (SIZEOF(ControlPointsList) - 1)" }, - "description": "The upper index on the array of control points; the lower index is 0. This value is derived from the control points list. (SIZEOF(ControlPointsList) - 1)", + "description": "Definition from ISO/CD 10303-42:1992: A B-spline curve is a piecewise parametric polynomial or rational curve described in terms of control points and basis functions. The B-spline curve has been selected as the most stable format to represent all types of polynomial or rational parametric curves. With appropriate attribute values it is capable of representing single span or spline curves of explicit polynomial, rational, Bezier or B-spline type.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcbsplinecurve.htm" }, "IfcBeam": { @@ -299,7 +299,7 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a beam element from which the type required may be set." }, - "description": "Identifies the predefined types of a beam element from which the type required may be set.", + "description": "The element type (IfcBeamType) defines a list of commonly shared property set definitions of a beam and an optional set of product representations. It is used to define a beam specification (i.e. the specific product information that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcbeamtype.htm" }, "IfcBezierCurve": { @@ -311,7 +311,7 @@ "RasterCode": "Blob, given as a single binary, to capture the texture within one popular file (compression) format.", "RasterFormat": "The format of the _RasterCode_ often using a compression." }, - "description": "Blob, given as a single binary, to capture the texture within one popular file (compression) format.", + "description": "An IfcBlobTexture provides a 2-dimensional distribution of the lighting parameters of a surface onto which it is mapped. The texture itself is given as a single binary, representing the content of a pixel format. The file format of the pixel file is given by the RasterFormat attribute and allowable formats are guided by where rule WR41.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcblobtexture.htm" }, "IfcBlock": { @@ -320,14 +320,14 @@ "YLength": "The size of the block along the placement Y axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[2]_.", "ZLength": "The size of the block along the placement Z axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[3]_." }, - "description": "The size of the block along the placement Z axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[3]_.", + "description": "Definition from ISO/CD 10303-42:1992: A block is a solid rectangular parallelepiped, defined with a location and placement coordinate system. The block is specified by the positive lengths x, y, and z along the axes of the placement coordinate system, and has one vertex at the origin of the placement coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcblock.htm" }, "IfcBoilerType": { "attributes": { "PredefinedType": "Defines types of boilers." }, - "description": "Defines types of boilers.", + "description": "The element type IfcBoilerType defines a list of commonly shared property set definitions of a boiler and an optional set of product representations. It is used to define a boiler specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcboilertype.htm" }, "IfcBooleanClippingResult": { @@ -341,14 +341,14 @@ "Operator": "The Boolean operator used in the operation to create the result.", "SecondOperand": "The second operand specified for the operation." }, - "description": "The space dimensionality of this entity. It is identical with the space dimensionality of the first operand. A where rule ensures that both operands have the same space dimensionality. FirstOperand.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A Boolean result is the result of a regularized operation on two solids to create a new solid. Valid operations are regularized union, regularized intersection, and regularized difference. For purpose of Boolean operations, a solid is considered to be a regularized set of points. The final Boolean result depends upon the operation and the two operands. In the case of the difference operator the order of the operands is also significant. The operator can be either union, intersection or difference. The effect of these operators is described below:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcbooleanresult.htm" }, "IfcBoundaryCondition": { "attributes": { "Name": "Optionally defines a name for this boundary condition." }, - "description": "Optionally defines a name for this boundary condition.", + "description": "Definition from IAI: The abstract entity IfcBoundaryCondition is the supertype of all boundary conditions that can be applied to structural connection definitions, either directly for the connection (e.g. the joint) or for the relation between a structural member and the connection.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcboundarycondition.htm" }, "IfcBoundaryEdgeCondition": { @@ -360,7 +360,7 @@ "RotationalStiffnessByLengthY": "Rotational stiffness value about the y-axis of the coordinate system defined by the instance which uses this resource object.", "RotationalStiffnessByLengthZ": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object." }, - "description": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object.", + "description": "Definition from IAI: The entity IfcBoundaryEdgeCondition describes boundary conditions that can be applied to structural edge connections, either directly for the connection (e.g. the connecting edge) or for the relation between a structural member and the connection.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcboundaryedgecondition.htm" }, "IfcBoundaryFaceCondition": { @@ -369,7 +369,7 @@ "LinearStiffnessByAreaY": "Linear stiffness value in y-direction of the coordinate system defined by the instance which uses this resource object.", "LinearStiffnessByAreaZ": "Linear stiffness value in z-direction of the coordinate system defined by the instance which uses this resource object." }, - "description": "Linear stiffness value in z-direction of the coordinate system defined by the instance which uses this resource object.", + "description": "Definition from IAI: The entity IfcBoundaryFaceCondition describes boundary conditions that can be applied to structural face connections, either directly for the connection (e.g. the connecting face) or for the relation between a structural member and the connection.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcboundaryfacecondition.htm" }, "IfcBoundaryNodeCondition": { @@ -381,14 +381,14 @@ "RotationalStiffnessY": "Rotational stiffness value about the y-axis of the coordinate system defined by the instance which uses this resource object.", "RotationalStiffnessZ": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object." }, - "description": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object.", + "description": "Definition from IAI: The entity IfcBoundaryNodeCondition describes boundary conditions that can be applied to structural point connections, either directly for the connection (e.g. the joint) or for the relation between a structural member and the connection. ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcboundarynodecondition.htm" }, "IfcBoundaryNodeConditionWarping": { "attributes": { "WarpingStiffness": "Defines the warping stiffness value." }, - "description": "Defines the warping stiffness value.", + "description": "IfcBoundaryNodeConditionWarping inherits all attributes from IfcBoundaryNodeCondition and includes additionally the possibility to define a value describing the warping stiffness.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcboundarynodeconditionwarping.htm" }, "IfcBoundedCurve": { @@ -407,14 +407,14 @@ "YDim": "Width attribute (measured along the edge parallel to the Y Axis)", "ZDim": "Height attribute (measured along the edge parallel to the Z Axis)." }, - "description": "The space dimensionality of this class, it is always 3. 3", + "description": "Definition from ISO/CD 10303-42:1992: A box domain is an orthogonal box parallel to the axes of the geometric coordinate system which may be used to limit the domain of a half space solid. A box domain is specified by the coordinates of the bottom left corner, and the lengths of the sides measured in the directions of the coordinate axes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcboundingbox.htm" }, "IfcBoxedHalfSpace": { "attributes": { "Enclosure": "The box which bounds the half space for computational purposes only." }, - "description": "The box which bounds the half space for computational purposes only.", + "description": "Definition from ISO/CD 10303-42:1992: This entity is a subtype of the half space solid which is trimmed by a surrounding rectangular box. The box has its edges parallel to the coordinate axes of the geometric coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcboxedhalfspace.htm" }, "IfcBuilding": { @@ -423,7 +423,7 @@ "ElevationOfRefHeight": "Elevation above sea level of the reference height used for all storey elevation measures, equals to height 0.0. It is usually the ground floor level.", "ElevationOfTerrain": "Elevation above the minimal terrain level around the foot print of the building, given in elevation above sea level." }, - "description": "Address given to the building for postal purposes.", + "description": "Definition from ISO 6707-1:1989: Construction work that has the provision of shelter for its occupants or contents as one of its main purpose and is normally designed to stand permanently in one place.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcbuilding.htm" }, "IfcBuildingElement": { @@ -442,14 +442,14 @@ "attributes": { "CompositionType": "Indication, whether the proxy is intended to form an aggregation (COMPLEX), an integral element (ELEMENT), or a part in an aggregation (PARTIAL)." }, - "description": "Indication, whether the proxy is intended to form an aggregation (COMPLEX), an integral element (ELEMENT), or a part in an aggregation (PARTIAL).", + "description": "The IfcBuildingElementProxy is a proxy definition that provides the same functionality as an IfcBuildingElement, but without having a defined meaning of the special type of building element, it represents.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcbuildingelementproxy.htm" }, "IfcBuildingElementProxyType": { "attributes": { "PredefinedType": "Predefined types to define the particular type of an building element proxy. There may be property set definitions available for each predefined or user defined type." }, - "description": "Predefined types to define the particular type of an building element proxy. There may be property set definitions available for each predefined or user defined type.", + "description": "The IfcBuildingElementProxyType defines a list of commonly shared property set definitions of a building element proxy and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcbuildingelementproxytype.htm" }, "IfcBuildingElementType": { @@ -460,40 +460,40 @@ "attributes": { "Elevation": "Elevation of the base of this storey, relative to the 0,00 internal reference height of the building. The 0.00 level is given by the absolute above sea level height by the ElevationOfRefHeight attribute given at IfcBuilding." }, - "description": "Elevation of the base of this storey, relative to the 0,00 internal reference height of the building. The 0.00 level is given by the absolute above sea level height by the ElevationOfRefHeight attribute given at IfcBuilding.", + "description": "The building storey has an elevation and typically represents a (nearly) horizontal aggregation of spaces that are vertically bound.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcbuildingstorey.htm" }, "IfcCShapeProfileDef": { "attributes": { - "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box.", "Depth": "Profile depth, see illustration above (= h).", "Girth": "Lengths of girth, see illustration above (= c).", "InternalFilletRadius": "Internal fillet radius according the above illustration (= r1). If it is not given, zero is assumed.", "WallThickness": "Constant wall thickness of profile (= ts).", "Width": "Profile width, see illustration above (= b)." }, - "description": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "The IfcCShapeProfileDef defines a section profile that provides the defining parameters of a C-shaped section to be used by the swept area solid. This section is typically produced by cold forming steel. Its parameters and orientation relative to the position coordinate system are according to the following illustration.The centre of the position coordinate system is in the profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccshapeprofiledef.htm" }, "IfcCableCarrierFittingType": { "attributes": { "PredefinedType": "Identifies the predefined types of cable carrier fitting from which the type required may be set." }, - "description": "Identifies the predefined types of cable carrier fitting from which the type required may be set.", + "description": "An IfcCableCarrierFittingType defines a particular type of cable carrier fitting which is a fitting that is placed at junction or transition in a cable carrier system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifccablecarrierfittingtype.htm" }, "IfcCableCarrierSegmentType": { "attributes": { "PredefinedType": "Identifies the predefined types of cable carrier segment from which the type required may be set." }, - "description": "Identifies the predefined types of cable carrier segment from which the type required may be set.", + "description": "The IfcCableCarrierSegmentType is a flow segment that is specifically used to carry and support cabling.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifccablecarriersegmenttype.htm" }, "IfcCableSegmentType": { "attributes": { "PredefinedType": "Identifies the predefined types of cable segment from which the type required may be set." }, - "description": "Identifies the predefined types of cable segment from which the type required may be set.", + "description": "An IfcCableSegmentType is a type of flow segment used to carry electrical power or communications signals.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifccablesegmenttype.htm" }, "IfcCalendarDate": { @@ -502,7 +502,7 @@ "MonthComponent": "The month element of the calendar date.", "YearComponent": "The year element of the calendar date." }, - "description": "The year element of the calendar date.", + "description": "Definition from ISO/CD 10303-41:1992: A date which is defined by a day in a month of a year.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcdatetimeresource/lexical/ifccalendardate.htm" }, "IfcCartesianPoint": { @@ -510,7 +510,7 @@ "Coordinates": "The first, second, and third coordinate of the point location. If placed in a two or three dimensional rectangular Cartesian coordinate system, Coordinates[1] is the X coordinate, Coordinates[2] is the Y coordinate, and Coordinates[3] is the Z coordinate.", "Dim": "The space dimensionality of this class, determined by the number of coordinates in the List of Coordinates. HIINDEX(Coordinates)" }, - "description": "The space dimensionality of this class, determined by the number of coordinates in the List of Coordinates. HIINDEX(Coordinates)", + "description": "Definition from ISO/CD 10303-42:1992: A point defined by its coordinates in a two or three dimensional rectangular Cartesian coordinate system, or in a two dimensional parameter space. The entity is defined in a two or three dimensional space.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesianpoint.htm" }, "IfcCartesianTransformationOperator": { @@ -522,14 +522,14 @@ "Scale": "The scaling value specified for the transformation.", "Scl": "The derived scale S of the transformation, equal to scale if that exists, or 1.0 otherwise. NVL(Scale, 1.0)" }, - "description": "The space dimensionality of this class, determined by the space dimensionality of the local origin. LocalOrigin.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A Cartesian transformation operator defines a geometric transformation composed of translation, rotation, mirroring and uniform scaling. The list of normalized vectors u defines the columns of an orthogonal matrix T. These vectors are computed, by the base axis function, from the direction attributes axis1, axis2 and, in Cartesian transformation operator 3d, axis3. If |T|= -1, the transformation includes mirroring. The local origin point A, the scale value S and the matrix T together define a transformation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesiantransformationoperator.htm" }, "IfcCartesianTransformationOperator2D": { "attributes": { "U": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis1 and Axis2 in that order. IfcBaseAxis(2,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,?)" }, - "description": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis1 and Axis2 in that order. IfcBaseAxis(2,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,?)", + "description": "Definition from ISO/CD 10303-42:1992: A Cartesian transformation operator 2d defines a geometric transformation in two-dimensional space composed of translation, rotation, mirroring and uniform scaling. The list of normalized vectors u defines the columns of an orthogonal matrix T. These vectors are computed from the direction attributes axis1 and axis2 by the base axis function. If |T|= -1, the transformation includes mirroring.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesiantransformationoperator2d.htm" }, "IfcCartesianTransformationOperator2DnonUniform": { @@ -537,7 +537,7 @@ "Scale2": "The scaling value specified for the transformation along the axis 2. This is normally the y scale factor.", "Scl2": "The derived scale S(2) of the transformation along the axis 2 (normally the y axis), equal to Scale2 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale2, SELF\\IfcCartesianTransformationOperator.Scl)" }, - "description": "The derived scale S(2) of the transformation along the axis 2 (normally the y axis), equal to Scale2 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale2, SELF\\IfcCartesianTransformationOperator.Scl)", + "description": "A Cartesian transformation operator 2d non uniform defines a geometric transformation in two-dimensional space composed of translation, rotation, mirroring and non uniform scaling. Non uniform scaling is given by two different scaling factors:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesiantransformationoperator2dnonuniform.htm" }, "IfcCartesianTransformationOperator3D": { @@ -545,7 +545,7 @@ "Axis3": "The exact direction of U[3], the derived Z axis direction.", "U": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis3, Axis1, and Axis2 in that order. IfcBaseAxis(3,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,Axis3)" }, - "description": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis3, Axis1, and Axis2 in that order. IfcBaseAxis(3,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,Axis3)", + "description": "Definition from ISO/CD 10303-42:1992: A Cartesian transformation operator 3d defines a geometric transformation in three-dimensional space composed of translation, rotation, mirroring and uniform scaling. The list of normalized vectors u defines the columns of an orthogonal matrix T. These vectors are computed from the direction attributes axis1, axis2 and axis3 by the base axis function. If |T|= -1, the transformation includes mirroring.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesiantransformationoperator3d.htm" }, "IfcCartesianTransformationOperator3DnonUniform": { @@ -555,14 +555,14 @@ "Scl2": "The derived scale S(2) of the transformation along the axis 2 (normally the y axis), equal to Scale2 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale2, SELF\\IfcCartesianTransformationOperator.Scl)", "Scl3": "The derived scale S(3) of the transformation along the axis 3 (normally the z axis), equal to Scale3 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale3, SELF\\IfcCartesianTransformationOperator.Scl)" }, - "description": "The derived scale S(3) of the transformation along the axis 3 (normally the z axis), equal to Scale3 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale3, SELF\\IfcCartesianTransformationOperator.Scl)", + "description": "A Cartesian transformation operator 3d non uniform defines a geometric transformation in three-dimensional space composed of translation, rotation, mirroring and non uniform scaling. Non uniform scaling is given by three different scaling factors:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccartesiantransformationoperator3dnonuniform.htm" }, "IfcCenterLineProfileDef": { "attributes": { "Thickness": "Constant thickness applied along the center line." }, - "description": "Constant thickness applied along the center line.", + "description": "The profile IfcCenterLineProfileDef defines an arbitrary two-dimensional open, not self intersecting profile for the use within the swept solid geometry. It is given by an area defined by applying a constant thickness to a centerline, generating an area from which the solid can be constructed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccenterlineprofiledef.htm" }, "IfcChamferEdgeFeature": { @@ -570,35 +570,35 @@ "Height": "The height of the feature chamfer cross section.", "Width": "The width of the feature chamfer cross section." }, - "description": "The height of the feature chamfer cross section.", + "description": "An edge feature with a chamfered cross section shape.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedcomponentelements/lexical/ifcchamferedgefeature.htm" }, "IfcChillerType": { "attributes": { "PredefinedType": "Defines the typical types of chillers (e.g., air-cooled, water-cooled, etc.)." }, - "description": "Defines the typical types of chillers (e.g., air-cooled, water-cooled, etc.).", + "description": "The element type IfcChillerType defines a list of commonly shared property set definitions of a chiller and an optional set of product representations. It is used to define a chiller specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcchillertype.htm" }, "IfcCircle": { "attributes": { "Radius": "The radius of the circle, which shall be greater than zero." }, - "description": "The radius of the circle, which shall be greater than zero.", + "description": "Definition from ISO/CD 10303-42:1992: An IfcCircle is defined by a radius and the location and orientation of the circle. Interpretation of data should be as follows:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccircle.htm" }, "IfcCircleHollowProfileDef": { "attributes": { "WallThickness": "Thickness of the material, it is the difference between the outer and inner radius." }, - "description": "Thickness of the material, it is the difference between the outer and inner radius.", + "description": "Definition from IAI: The IfcCircleHollowProfileDef defines a section profile that provides the defining parameters of a circular hollow section (tube) to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration.The centre of the position coordinate system is in the profile's centre of the bounding box (for symmetric profiles identical with the centre of gravity).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccirclehollowprofiledef.htm" }, "IfcCircleProfileDef": { "attributes": { "Radius": "The radius of the circle." }, - "description": "The radius of the circle.", + "description": "Definition from IAI: The IfcCircleProfileDef defines a circle as the profile definition used by the swept surface geometry or by the swept area solid. It is given by its Radius attribute and placed within the 2D position coordinate system, established by the Position attribute.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccircleprofiledef.htm" }, "IfcClassification": { @@ -609,7 +609,7 @@ "Name": "The name or label by which the classification used is normally known. NOTE: Examples of names include CI/SfB, Masterformat, BSAB, Uniclass, STABU etc.", "Source": "Source (or publisher) for this classification." }, - "description": "Classification items that are classified by the classification.", + "description": "An IfcClassification is used for the arrangement of objects into a class or category according to a common purpose or their possession of common characteristics.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassification.htm" }, "IfcClassificationItem": { @@ -620,7 +620,7 @@ "Notation": "The notations from within a classification item that are used within the project. NOTE: In Uniclass this label is called the Code, in UDC it is called the Class Number.", "Title": "The name of the classification item. NOTE: Examples of the above attributes from Uniclass: A classification item in Uniclass has a notation \"L6814\" which has the title \"Tanking\". It has a parent notation \"L681\" which has the title \"Proofings, insulation\"." }, - "description": "Identifies the relationship in which the role of ClassifyingItem is taken.", + "description": "An IfcClassificationItem is a class of classification notations used.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassificationitem.htm" }, "IfcClassificationItemRelationship": { @@ -628,28 +628,28 @@ "RelatedItems": "The child level items in a classification structure that are related to the parent level item.", "RelatingItem": "The parent level item in a classification structure that is used for relating the child level items." }, - "description": "The child level items in a classification structure that are related to the parent level item.", + "description": "An IfcClassificationItemRelationship is a relationship class that enables the hierarchical structure of a classification system to be exposed through its ability to contain related classification items and to be contained by a relating classification item.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassificationitemrelationship.htm" }, "IfcClassificationNotation": { "attributes": { "NotationFacets": "Alphanumeric characters in defined groups from which the classification notation is derived." }, - "description": "Alphanumeric characters in defined groups from which the classification notation is derived.", + "description": "An IfcClassificationNotation is a notation used from published reference (which may be either publicly available from a classification society or is published locally for the purposes of an organization, project or other purpose).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassificationnotation.htm" }, "IfcClassificationNotationFacet": { "attributes": { "NotationValue": "The notation value that specifies the classification e.g. 'L781'" }, - "description": "The notation value that specifies the classification e.g. 'L781'", + "description": "An IfcClassificationNotationFacet is a group of alphanumeric characters used within a classification notation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassificationnotationfacet.htm" }, "IfcClassificationReference": { "attributes": { "ReferencedSource": "The classification system or source that is referenced." }, - "description": "The classification system or source that is referenced.", + "description": "An IfcClassificationReference is a reference into a classification system or source (see IfcClassification). An optional inherited ItemReference key is also provided to allow more specific references to classification items (or tables) by type. The inherited Name attribute allows for a human interpretable designation of a classification notation (or code) - see use definition of \"Lightweight Classification\".", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcclassificationreference.htm" }, "IfcClosedShell": { @@ -660,23 +660,23 @@ "attributes": { "PredefinedType": "Defines typical types of coils (e.g., Cooling, Heating, etc.)" }, - "description": "Defines typical types of coils (e.g., Cooling, Heating, etc.)", + "description": "The element type IfcCoilType defines a list of commonly shared property set definitions of a coil and an optional set of product representations. It is used to define a coil specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifccoiltype.htm" }, "IfcColourRgb": { "attributes": { - "Blue": "The intensity of the blue colour component. > NOTE&npsp; The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual. ", - "Green": "The intensity of the green colour component. > NOTE&npsp; The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual. ", - "Red": "The intensity of the red colour component. > NOTE&npsp; The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual. " + "Blue": "The intensity of the blue colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual.", + "Green": "The intensity of the green colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual.", + "Red": "The intensity of the red colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual." }, - "description": "The intensity of the blue colour component. > NOTE&npsp; The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual. ", + "description": "Definition from ISO/CD 10303-46:1992: A colour rgb as a subtype of colour specifications is defined by three colour component values for red, green, and blue in the RGB colour model.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifccolourrgb.htm" }, "IfcColourSpecification": { "attributes": { - "Name": "Optional name given to a particular colour specification in addition to the colour components (like the RGB values). > NOTE  Examples are the names of a industry colour classification, such as RAL.
IFC2x Edition 3 CHANGE  Attribute added. " + "Name": "Optional name given to a particular colour specification in addition to the colour components (like the RGB values). > NOTE Examples are the names of a industry colour classification, such as RAL." }, - "description": "Optional name given to a particular colour specification in addition to the colour components (like the RGB values). > NOTE  Examples are the names of a industry colour classification, such as RAL.
IFC2x Edition 3 CHANGE  Attribute added. ", + "description": "Definition from ISO/CD 10303-46:1992: The colour specification entity contains a direct colour definition. Colour component values refer directly to a specific colour space.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifccolourspecification.htm" }, "IfcColumn": { @@ -687,15 +687,15 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a column element from which the type required may be set." }, - "description": "Identifies the predefined types of a column element from which the type required may be set.", + "description": "The element type (IfcColumnType) defines a list of commonly shared property set definitions of a column and an optional set of product representations. It is used to define a column specification (i.e. the specific product information that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifccolumntype.htm" }, "IfcComplexProperty": { "attributes": { "HasProperties": "Set of properties that can be used within this complex property (may include other complex properties).", - "UsageName": "Usage description of the _IfcComplexProperty_ within the property set which references the _IfcComplexProperty_. > NOTE: Consider a complex property for glazing properties. The Name attribute of the IfcComplexProperty could be Pset_GlazingProperties, and the UsageName attribute could be OuterGlazingPane." + "UsageName": "Usage description of the _IfcComplexProperty_ within the property set which references the _IfcComplexProperty_. > NOTE: Consider a complex property for glazing properties. The Name attribute of the IfcComplexProperty could be Pset_GlazingProperties, and the UsageName attribute could be OuterGlazingPane." }, - "description": "Set of properties that can be used within this complex property (may include other complex properties).", + "description": "This IfcComplexProperty is used to define complex properties to be handled completely within a property set. The included list may be a mixed or consistent collection of IfcProperty subtypes. This enables the definition of a list of properties to be included as a single 'property' entry in a property set. The definition of such a list can be reused in many different property sets, but the instantiation of such a complex property shall only be used within a single property set.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifccomplexproperty.htm" }, "IfcCompositeCurve": { @@ -705,7 +705,7 @@ "Segments": "The component bounded curves, their transitions and senses. The transition attribute for the last segment defines the transition between the end of the last segment and the start of the first; this transition attribute may take the value discontinuous, which indicates an open curve.", "SelfIntersect": "Indication of whether the curve intersects itself or not; this is for information only." }, - "description": "Indication whether the curve is closed or not; this is derived from the transition code of the last segment. Segments[NSegments].Transition <> Discontinuous", + "description": "Definition from ISO/CD 10303-42:1992: A composite curve (IfcCompositeCurve) is a collection of curves joined end-to-end. The individual segments of the curve are themselves defined as composite curve segments. The parameterization of the composite curve is an accumulation of the parametric ranges of the referenced bounded curves. The first segment is parameterized from 0 to l~1~~, and, for i\u00b3 2, the i^th^^ segment is parameterized from", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccompositecurve.htm" }, "IfcCompositeCurveSegment": { @@ -716,7 +716,7 @@ "Transition": "The state of transition (i.e., geometric continuity from the last point of this segment to the first point of the next segment) in a composite curve.", "UsingCurves": "The set of composite curves which use this composite curve segment as a segment. This set shall not be empty." }, - "description": "The set of composite curves which use this composite curve segment as a segment. This set shall not be empty.", + "description": "Definition from ISO/CD 10303-42:1992: A composite curve segment (IfcCompositeCurveSegment) is a bounded curve together with transition information which is used to construct a composite curve (IfcCompositeCurve).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccompositecurvesegment.htm" }, "IfcCompositeProfileDef": { @@ -724,21 +724,21 @@ "Label": "The name by which the composition may be referred to. The actual meaning of the name has to be defined in the context of applications.", "Profiles": "The profiles which are used to define the composite profile." }, - "description": "The name by which the composition may be referred to. The actual meaning of the name has to be defined in the context of applications.", + "description": "Definition from IAI: The IfcCompositeProfileDef defines the profile by composition of other profiles. The composition is given by a set of at least two other profile definitions. Any profile definition (except for another composite profile) can be used to construct the composite.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccompositeprofiledef.htm" }, "IfcCompressorType": { "attributes": { "PredefinedType": "Defines the type of compressor (e.g., hermetic, reciprocating, etc.)." }, - "description": "Defines the type of compressor (e.g., hermetic, reciprocating, etc.).", + "description": "The element type IfcCompressorType defines a list of commonly shared property set definitions of a compressor and an optional set of product representations. It is used to define a compressor specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifccompressortype.htm" }, "IfcCondenserType": { "attributes": { "PredefinedType": "Defines the type of condenser." }, - "description": "Defines the type of condenser.", + "description": "The element type IfcCondenserType defines a list of commonly shared property set definitions of a condenser and an optional set of product representations. It is used to define a condenser specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifccondensertype.htm" }, "IfcCondition": { @@ -750,21 +750,21 @@ "Criterion": "The measured or assessed value of a criterion.", "CriterionDateTime": "The time and/or date at which the criterion is determined." }, - "description": "The time and/or date at which the criterion is determined.", + "description": "An IfcConditionCriterion is a particular measured or assessed criterion that contributes to the overall condition of an artifact.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcfacilitiesmgmtdomain/lexical/ifcconditioncriterion.htm" }, "IfcConic": { "attributes": { "Position": "The location and orientation of the conic. Further details of the interpretation of this attribute are given for the individual subtypes.\"" }, - "description": "The location and orientation of the conic. Further details of the interpretation of this attribute are given for the individual subtypes.\"", + "description": "Definition from ISO/CD 10303-42:1992: A conic (IfcConic) is a planar curve which could be produced by intersecting a plane with a cone. A conic is defined in terms of its intrinsic geometric properties rather than being described in terms of other geometry. A conic class always has a placement coordinate system defined by a two or three dimensional placement. The parametric representation is defined in terms of this placement coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcconic.htm" }, "IfcConnectedFaceSet": { "attributes": { "CfsFaces": "The set of faces arcwise connected along common edges or vertices." }, - "description": "The set of faces arcwise connected along common edges or vertices.", + "description": "Definition from ISO/CD 10303-42:1992: A connected_face_set is a set of faces such that the domain of faces together with their bounding edges and vertices is connected.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcconnectedfaceset.htm" }, "IfcConnectionCurveGeometry": { @@ -772,7 +772,7 @@ "CurveOnRelatedElement": "The bounded curve at which the connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", "CurveOnRelatingElement": "The bounded curve at which the connected objects are aligned at the relating element, given in the LCS of the relating element." }, - "description": "The bounded curve at which the connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "description": "The IfcConnectionCurveGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a curve or at an edge with curve geometry associated. It is envisioned as a control that applies to the element connection relationships.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcconnectioncurvegeometry.htm" }, "IfcConnectionGeometry": { @@ -785,7 +785,7 @@ "EccentricityInY": "Distance in y direction between the two points (or vertex points) engaged in the point connection.", "EccentricityInZ": "Distance in z direction between the two points (or vertex points) engaged in the point connection." }, - "description": "Distance in z direction between the two points (or vertex points) engaged in the point connection.", + "description": "The IfcConnectionPointEccentricity is used to describe the geometric constraints that facilitate the physical connection of two objects at a point or vertex point with associated point coordinates. There is a physical distance, or eccentricity, between the connection points of both object. The eccentricity can be either given by:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcconnectionpointeccentricity.htm" }, "IfcConnectionPointGeometry": { @@ -793,7 +793,7 @@ "PointOnRelatedElement": "Point at which connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", "PointOnRelatingElement": "Point at which the connected object is aligned at the relating element, given in the LCS of the relating element." }, - "description": "Point at which connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "description": "The IfcConnectionPointGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a point (here IfcCartesianPoint) or at an vertex with point coordinates associated. It is envisioned as a control that applies to the element connection relationships.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcconnectionpointgeometry.htm" }, "IfcConnectionPortGeometry": { @@ -802,7 +802,7 @@ "LocationAtRelatingElement": "Local placement of the port relative to its distribution element's local placement. The element in question is that, which plays the role of the relating element in the connectivity relationship.", "ProfileOfPort": "Profile that defines the port connection geometry. It is placed inside the XY plane of the location, given at the relating and (optionally) related distribution element." }, - "description": "Profile that defines the port connection geometry. It is placed inside the XY plane of the location, given at the relating and (optionally) related distribution element.", + "description": "The IfcConnectionPortGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a port having a profile geometry (here IfcProfile). It is envisioned as a control that applies to the element connection relationships.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcconnectionportgeometry.htm" }, "IfcConnectionSurfaceGeometry": { @@ -810,7 +810,7 @@ "SurfaceOnRelatedElement": "Surface at which the relating element is aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", "SurfaceOnRelatingElement": "Surface at which related object is aligned at the relating element, given in the LCS of the relating element." }, - "description": "Surface at which the relating element is aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "description": "The IfcConnectionSurfaceGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a surface or at a face with surface geometry associated. It is envisioned as a control that applies to the element connection relationships.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcconnectionsurfacegeometry.htm" }, "IfcConstraint": { @@ -829,7 +829,7 @@ "RelatesConstraints": "References to the objectified relationships that relate other constraints with this constraint.", "UserDefinedGrade": "Allows for specification of user defined grade of the constraint beyond the enumeration values (hard, soft, advisory) provided by ConstraintGrade attribute of type _IfcConstraintEnum_. When a value is provided for attribute UserDefinedGrade in parallel the attribute ConstraintGrade shall have enumeration value USERDEFINED." }, - "description": "Reference to the relationships that relate this constraint into aggregate constraints.", + "description": "An IfcConstraint is used to define a constraint or limiting value or boundary condition that may be applied to an object or to the value of a property.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcconstraint.htm" }, "IfcConstraintAggregationRelationship": { @@ -840,7 +840,7 @@ "RelatedConstraints": "Constraints that are aggregated in using the LogicalAggregator.", "RelatingConstraint": "Constraint to which the other Constraints are associated." }, - "description": "Enumeration that identifies the logical type of aggregation.", + "description": "An IfcConstraintAggregationRelationship is an objectified relationship that enables instances of IfcConstraint and its subtypes to be aggregated together logically.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcconstraintaggregationrelationship.htm" }, "IfcConstraintClassificationRelationship": { @@ -848,7 +848,7 @@ "ClassifiedConstraint": "Constraint being classified", "RelatedClassifications": "Classifications of the constraint." }, - "description": "Classifications of the constraint.", + "description": "An IfcClassificationConstraintRelationship is an objectified relationship that enables assigning classifications to instances of IfcConstraint and its subtypes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcconstraintclassificationrelationship.htm" }, "IfcConstraintRelationship": { @@ -858,7 +858,7 @@ "RelatedConstraints": "Constraints that are related with the RelatingConstraint.", "RelatingConstraint": "Constraint with which the other Constraints referenced by attribute RelatedConstraints are related." }, - "description": "Constraints that are related with the RelatingConstraint.", + "description": "An IfcConstraintRelationship is an objectified relationship that enables instances of IfcConstraint and its subtypes to be associated to each other.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcconstraintrelationship.htm" }, "IfcConstructionEquipmentResource": { @@ -870,7 +870,7 @@ "Suppliers": "Possible suppliers of the type of materials.", "UsageRatio": "The ratio of the amount of a construction material used to the amount provided (determined as a quantity)" }, - "description": "The ratio of the amount of a construction material used to the amount provided (determined as a quantity)", + "description": "An IfcConstructionMaterialResource identifies a material resource type in a construction project.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstructionmgmtdomain/lexical/ifcconstructionmaterialresource.htm" }, "IfcConstructionProductResource": { @@ -884,28 +884,28 @@ "ResourceGroup": "The group label, or title of the type resource, e.g. the title of a labour resource as carpenter, crane operator, superintendent, etc.", "ResourceIdentifier": "Optional identification of a code or ID for the construction resource" }, - "description": "The basic (i.e. default, or recommended) unit that should be used for measuring the volume (or amount) of the resource and the basic quantity of the resource fully or partially consumed.", + "description": "An IfcConstructionResource is an abstract generalization of the different resources used in construction projects, mainly labor, material, equipment and product resources, plus subcontracted resources and aggregations, such as a crew resource.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstructionmgmtdomain/lexical/ifcconstructionresource.htm" }, "IfcContextDependentUnit": { "attributes": { "Name": "The word, or group of words, by which the context dependent unit is referred to." }, - "description": "The word, or group of words, by which the context dependent unit is referred to.", + "description": "Definition from ISO/CD 10303-41:1992: A context dependent unit is a unit which is not related to the SI system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifccontextdependentunit.htm" }, "IfcControl": { "attributes": { "Controls": "Reference to the relationship that associates the control to the object(s) being controlled." }, - "description": "Reference to the relationship that associates the control to the object(s) being controlled.", + "description": "The IfcControl is the abstract generalization of all concepts that control or constrain products or processes in general. It can be seen as a specification, regulation, cost schedule or other requirement applied to a product or process whose requirements and provisions must be fulfilled. Controls are assigned to products, processes, or other objects by using the IfcRelAssignsToControl relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifccontrol.htm" }, "IfcControllerType": { "attributes": { "PredefinedType": "Identifies the predefined types of controller from which the type required may be set." }, - "description": "Identifies the predefined types of controller from which the type required may be set.", + "description": "An IfcControllerType defines a particular type of controller that interacts with other devices in a control system such as a building automation control system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcbuildingcontrolsdomain/lexical/ifccontrollertype.htm" }, "IfcConversionBasedUnit": { @@ -913,30 +913,30 @@ "ConversionFactor": "The physical quantity from which the converted unit is derived.", "Name": "The word, or group of words, by which the conversion based unit is referred to." }, - "description": "The physical quantity from which the converted unit is derived.", + "description": "Definition from ISO/CD 10303-41:1992: A conversion based unit is a unit that is defined based on a measure with unit.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcconversionbasedunit.htm" }, "IfcCooledBeamType": { "attributes": { "PredefinedType": "Defines the type of cooled beam." }, - "description": "Defines the type of cooled beam.", + "description": "The element type IfcCooledBeamType defines a list of commonly shared property set definitions of a cooled beam and an optional set of product representations. It is used to define a cooled beam specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifccooledbeamtype.htm" }, "IfcCoolingTowerType": { "attributes": { "PredefinedType": "Defines the typical types of cooling towers (e.g., OpenTower, ClosedTower, CrossFlow, etc.)." }, - "description": "Defines the typical types of cooling towers (e.g., OpenTower, ClosedTower, CrossFlow, etc.).", + "description": "The element type IfcCoolingTowerType defines a list of commonly shared property set definitions of a cooling tower and an optional set of product representations. It is used to define a cooling tower specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifccoolingtowertype.htm" }, "IfcCoordinatedUniversalTimeOffset": { "attributes": { "HourOffset": "The number of hours by which local time is offset from coordinated universal time.", "MinuteOffset": "The number of minutes by which local time is offset from coordinated universal time.", - "Sense": "The direction of the offset. > Note: The data type of the Sense is an enumeration - AHEAD means positive offset; BEHIND means negative offset. " + "Sense": "The direction of the offset. > Note: The data type of the Sense is an enumeration - AHEAD means positive offset; BEHIND means negative offset." }, - "description": "The direction of the offset. > Note: The data type of the Sense is an enumeration - AHEAD means positive offset; BEHIND means negative offset. ", + "description": "Definition from ISO/CD 10303-41:1992: Relates a time to coordinated universal time by an offset (specified in hours and minutes) and direction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcdatetimeresource/lexical/ifccoordinateduniversaltimeoffset.htm" }, "IfcCostItem": { @@ -954,7 +954,7 @@ "TargetUsers": "The actors for whom the cost schedule was prepared.", "UpdateDate": "The date that this cost schedule is updated; this allows tracking the schedule history." }, - "description": "Predefined types of cost schedule from which that required may be selected.", + "description": "An IfcCostSchedule brings together instances of IfcCostItem either for the purpose of identifying purely cost information as in an estimate for constructions costs, bill of quantities etc. or for including cost information within another presentation form such as an order (of whatever type)", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedmgmtelements/lexical/ifccostschedule.htm" }, "IfcCostValue": { @@ -962,7 +962,7 @@ "Condition": "The condition under which a cost value applies.", "CostType": "Specification of the type of cost type used. > NOTE: There are many possible types of cost value that may be identified. Whilst there is a broad understanding of the meaning of names that may be assigned to different types of costs, there is no general standard for naming cost types nor are there any broadly defined classifications. To allow for any type of cost value, the IfcLabel datatype is assigned. In the absence of any well defined standard, it is recommended that local agreements should be made to define allowable and understandable cost value types within a project or region." }, - "description": "The condition under which a cost value applies.", + "description": "An IfcCostValue is an amount of money or a value that affects an amount of money.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifccostvalue.htm" }, "IfcCovering": { @@ -971,14 +971,14 @@ "CoversSpaces": "", "PredefinedType": "Predefined types to define the particular type of the covering. There may be property set definitions available for each predefined type." }, - "description": "Reference to the objectified relationship that handles the relationship of the covering to the covered space.", + "description": "Definition from ISO 6707-1:1989: term used: Finishing - final coverings and treatments of surfaces and their intersections.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifccovering.htm" }, "IfcCoveringType": { "attributes": { "PredefinedType": "Predefined types to define the particular type of the covering. There may be property set definitions available for each predefined type." }, - "description": "Predefined types to define the particular type of the covering. There may be property set definitions available for each predefined type.", + "description": "The IfcCoveringType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifccoveringtype.htm" }, "IfcCraneRailAShapeProfileDef": { @@ -988,7 +988,7 @@ "BaseDepth3": "Depth of the base where thickness changes, see illustration above (= s3).", "BaseWidth2": "Total extent of the width of the base, defined parallel to the x axis of the position coordinate system. See illustration above (= b2).", "BaseWidth4": "Width of the base where thickness changes, defined parallel to the x axis of the position coordinate system. See illustration above (= b4).", - "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box.", "HeadDepth2": "Head depth of the A shape crane rail, see illustration above (= h2).", "HeadDepth3": "Head depth of the A shape crane rail, see illustration above (= h3).", "HeadWidth": "Total extent of the width of the head, defined parallel to the x axis of the position coordinate system. See illustration above (= b1).", @@ -996,14 +996,14 @@ "Radius": "Edge radius according the above illustration (= r1).", "WebThickness": "Thickness of the web of the A shape crane rail. See illustration above (= b3)." }, - "description": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "Definition from IAI: The IfcCraneRailAShapeProfileDef defines a section profile that provides the defining parameters of a crane rail to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccranerailashapeprofiledef.htm" }, "IfcCraneRailFShapeProfileDef": { "attributes": { "BaseDepth1": "Base depth of the F shape crane rail, see illustration above (= s1).", "BaseDepth2": "Base depth of the F shape crane rail, see illustration above (= s2).", - "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInY": "Location of centre of gravity along the y axis measured from the center of the bounding box.", "HeadDepth2": "Head depth of the F shape crane rail, see illustration above (= h2).", "HeadDepth3": "Head depth of the F shape crane rail, see illustration above (= h3).", "HeadWidth": "Total extent of the width of the head, defined parallel to the x axis of the position coordinate system. See illustration above (= k)", @@ -1011,7 +1011,7 @@ "Radius": "Edge radius according the above illustration (= r1).", "WebThickness": "Thickness of the web of the F shape crane rail. See illustration above (= b3)" }, - "description": "Location of centre of gravity along the y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "Definition from IAI: The IfcCraneRailFShapeProfileDef defines a section profile that provides the defining parameters of a crane rail to be used by the swept surface geometry or the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifccranerailfshapeprofiledef.htm" }, "IfcCrewResource": { @@ -1023,14 +1023,14 @@ "Dim": "The space dimensionality of this geometric representation item, it is always 3. 3", "Position": "The placement coordinate system to which the parameters of each individual CSG primitive apply." }, - "description": "The space dimensionality of this geometric representation item, it is always 3. 3", + "description": "Definition from IAI: Abstract supertype of all three dimensional primitives used as either tree root item, or as Boolean results within an CSG solid model. All 3D CSG primitives are defined within an three-dimensional placement coordinate system,.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifccsgprimitive3d.htm" }, "IfcCsgSolid": { "attributes": { "TreeRootExpression": "Boolean expression of regularized operators describing the solid. The root of the tree of Boolean expressions is given explicitly as an IfcBooleanResult (the only item in the Select IfcCsgSelect)." }, - "description": "Boolean expression of regularized operators describing the solid. The root of the tree of Boolean expressions is given explicitly as an IfcBooleanResult (the only item in the Select IfcCsgSelect).", + "description": "Definition from ISO/CD 10303-42:1992: A solid represented as a CSG model is defined by a collection of so-called primitive solids, combined using regularized Boolean operations. The allowed operations are intersection, union, and difference. As a special case a CSG solid can also consists of a single CSG primitive.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifccsgsolid.htm" }, "IfcCurrencyRelationship": { @@ -1041,7 +1041,7 @@ "RelatedMonetaryUnit": "The monetary unit to which an exchange results. For instance, in the case of a conversion from GBP to USD, the related monetary unit is USD.", "RelatingMonetaryUnit": "The monetary unit from which an exchange is derived. For instance, in the case of a conversion from GBP to USD, the relating monetary unit is GBP." }, - "description": "The source from which an exchange rate is obtained.", + "description": "An IfcCurrencyRelationship defines the rate of exchange that applies between two designated currencies at a particular time and as published by a particular source.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifccurrencyrelationship.htm" }, "IfcCurtainWall": { @@ -1052,14 +1052,14 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a curtain wall element from which the type required may be set." }, - "description": "Identifies the predefined types of a curtain wall element from which the type required may be set.", + "description": "The element type (IfcCurtainWallType) defines a list of commonly shared property set definitions of a curtain wall element and an optional set of product representations. It is used to define a curtain wall specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifccurtainwalltype.htm" }, "IfcCurve": { "attributes": { "Dim": "The space dimensionality of this abstract class, defined differently for all subtypes, i.e. for IfcLine, IfcConic and IfcBoundedCurve. IfcCurveDim(SELF)" }, - "description": "The space dimensionality of this abstract class, defined differently for all subtypes, i.e. for IfcLine, IfcConic and IfcBoundedCurve. IfcCurveDim(SELF)", + "description": "Definition from ISO/CD 10303-42:1992: A curve can be envisioned as the path of a point moving in its coordinate space.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccurve.htm" }, "IfcCurveBoundedPlane": { @@ -1069,7 +1069,7 @@ "InnerBoundaries": "An optional set of inner boundaries. They shall not intersect each other or the outer boundary.", "OuterBoundary": "The outer boundary of the surface." }, - "description": "The space dimensionality of this class, defined by the dimensionality of the basis surface. BasisSurface.Dim", + "description": "Definition from ISO/CD 10303-42:1992: The curve bounded surface is a parametric surface with curved boundaries defined by one or more boundary curves. The bounded surface is defined to be the portion of the basis surface in the direction of N x T from any point on the boundary, where N is the surface normal and T the boundary curve tangent vector at this point. The region so defined shall be arcwise connected.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifccurveboundedplane.htm" }, "IfcCurveStyle": { @@ -1078,7 +1078,7 @@ "CurveFont": "A curve style font which is used to present a curve. It can either be a predefined curve font, or an explicitly defined curve font. Both may be scaled. If not given, then the curve font should be taken from the layer assignment with style, if that is not given either, then the default curve font applies.", "CurveWidth": "A positive length measure in units of the presentation area for the width of a presented curve. If not given, then the style should be taken from the layer assignment with style, if that is not given either, then the default style applies." }, - "description": "The colour of the visible part of the curve. If not given, then the colour should be taken from the layer assignment with style, if that is not given either, then the default colour applies.", + "description": "Definition from ISO/CD 10303-46:1992: A curve style specifies the visual appearance of curves.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifccurvestyle.htm" }, "IfcCurveStyleFont": { @@ -1086,7 +1086,7 @@ "Name": "Name that may be assigned with the curve font.", "PatternList": "A list of curve font pattern entities, that contains the simple patterns used for drawing curves. The patterns are applied in the order they occur in the list." }, - "description": "A list of curve font pattern entities, that contains the simple patterns used for drawing curves. The patterns are applied in the order they occur in the list.", + "description": "Definition from ISO/CD 10303-46:1992: A curve style font combines several curve style font pattern entities into a more complex pattern. The resulting pattern is repeated along the curve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifccurvestylefont.htm" }, "IfcCurveStyleFontAndScaling": { @@ -1095,22 +1095,22 @@ "CurveFontScaling": "The scale factor.", "Name": "Name that may be assigned with the scaling of a curve font." }, - "description": "The scale factor.", + "description": "Definition from ISO/CD 10303-46:1992: A curve style font and scaling is a curve style font and a scalar factor for that font, so that a given curve style font may be applied at various scales.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifccurvestylefontandscaling.htm" }, "IfcCurveStyleFontPattern": { "attributes": { "InvisibleSegmentLength": "The length of the invisible segment in the pattern definition.", - "VisibleSegmentLength": "The length of the visible segment in the pattern definition. > NOTE  For a visible segment representing a point, the value 0. should be assigned.
IFC2x Edition 3 CHANGE  The datatype has been changed to IfcLengthMeasure with upward compatibility for file-based exchange. " + "VisibleSegmentLength": "The length of the visible segment in the pattern definition. > NOTE For a visible segment representing a point, the value 0. should be assigned." }, - "description": "The length of the invisible segment in the pattern definition.", + "description": "Definition from ISO/CD 10303-46:1992: A curve style font pattern is a pair of visible and invisible curve segment length measures in presentation area units.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifccurvestylefontpattern.htm" }, "IfcDamperType": { "attributes": { "PredefinedType": "Type of damper." }, - "description": "Type of damper.", + "description": "The element type IfcDamperType defines a list of commonly shared property set definitions of a damper and an optional set of product representations. It is used to define a damper specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcdampertype.htm" }, "IfcDateAndTime": { @@ -1118,7 +1118,7 @@ "DateComponent": "The date element of the date time combination.", "TimeComponent": "The time element of the date time combination." }, - "description": "The time element of the date time combination.", + "description": "Definition from ISO/CD 10303-41:1992: A moment of time on a particular day.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcdatetimeresource/lexical/ifcdateandtime.htm" }, "IfcDefinedSymbol": { @@ -1126,7 +1126,7 @@ "Definition": "An implicit description of the symbol, either predefined or externally defined.", "Target": "A description of the placement, orientation and (uniform or non-uniform) scaling of the defined symbol." }, - "description": "A description of the placement, orientation and (uniform or non-uniform) scaling of the defined symbol.", + "description": "A defined symbol is a symbolic representation that gets its shape information by an established convention, either through a predefined symbol, or an externally defined symbol.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcdefinedsymbol.htm" }, "IfcDerivedProfileDef": { @@ -1135,7 +1135,7 @@ "Operator": "Transformation operator applied to the parent profile.", "ParentProfile": "The parent profile provides the origin of the transformation." }, - "description": "The name by which the transformation may be referred to. The actual meaning of the name has to be defined in the context of applications.", + "description": "Definition from IAI: The IfcDerivedProfileDef defines the profile by transformation from the parent profile. The transformation is given by a two dimensional transformation operator. Transformation includes translation, rotation, mirror and scaling. The latter can be uniform or non uniform. The derived profiles may be used to define swept surfaces, swept area solids or sectioned spines.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcderivedprofiledef.htm" }, "IfcDerivedUnit": { @@ -1145,7 +1145,7 @@ "UnitType": "Name of the derived unit chosen from an enumeration of derived unit types for use in IFC models.", "UserDefinedType": "" }, - "description": "Dimensional exponents derived using the function IfcDerivedDimensionalExponents using (SELF) as the input value. IfcDeriveDimensionalExponents(Elements)", + "description": "Definition from ISO/CD 10303-41:1992: A derived unit is an expression of units.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcderivedunit.htm" }, "IfcDerivedUnitElement": { @@ -1153,7 +1153,7 @@ "Exponent": "The power that is applied to the unit attribute.", "Unit": "The fixed quantity which is used as the mathematical factor." }, - "description": "The power that is applied to the unit attribute.", + "description": "Definition from ISO/CD 10303-41:1992: A derived unit element is one of the unit quantities which makes up a derived unit.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcderivedunitelement.htm" }, "IfcDiameterDimension": { @@ -1168,7 +1168,7 @@ "attributes": { "AnnotatedBySymbols": "Reference to the terminator symbols that may be assigned to the dimension curve. There shall be either zero, one or two terminator symbols assigned." }, - "description": "Reference to the terminator symbols that may be assigned to the dimension curve. There shall be either zero, one or two terminator symbols assigned.", + "description": "A dimension curve is an annotated curve within a dimension that has the dimension text and may have terminator symbols assigned. It is used to present the extent and the direction of the dimension.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdimensioningresource/lexical/ifcdimensioncurve.htm" }, "IfcDimensionCurveDirectedCallout": { @@ -1179,7 +1179,7 @@ "attributes": { "Role": "Role of the dimension curve terminator within a dimension curve (being either an origin or target)." }, - "description": "Role of the dimension curve terminator within a dimension curve (being either an origin or target).", + "description": "A dimension curve terminator is an annotated symbol, which is used at a dimension curve. It normally indicates the origin or target of the dimension curve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdimensioningresource/lexical/ifcdimensioncurveterminator.htm" }, "IfcDimensionPair": { @@ -1196,7 +1196,7 @@ "ThermodynamicTemperatureExponent": "The power of the thermodynamic temperature base quantity.", "TimeExponent": "The power of the time base quantity." }, - "description": "The power of the luminous intensity base quantity.", + "description": "Definition from ISO/CD 10303-41:1992: The dimensionality of any quantity can be expressed as a product of powers of the dimensions of base quantities. The dimensional exponents entity defines the powers of the dimensions of the base quantities. All the physical quantities are founded on seven base quantities (ISO 31 (clause 2)).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcdimensionalexponents.htm" }, "IfcDirection": { @@ -1204,7 +1204,7 @@ "Dim": "The space dimensionality of this class, defined by the number of real in the list of DirectionRatios. HIINDEX(DirectionRatios)", "DirectionRatios": "The components in the direction of X axis (DirectionRatios[1]), of Y axis (DirectionRatios[2]), and of Z axis (DirectionRatios[3])" }, - "description": "The space dimensionality of this class, defined by the number of real in the list of DirectionRatios. HIINDEX(DirectionRatios)", + "description": "Definition from ISO/CD 10303-42:1992: This entity defines a general direction vector in two or three dimensional space. The actual magnitudes of the components have no effect upon the direction being defined, only the ratios X:Y:Z or X:Y are significant.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcdirection.htm" }, "IfcDiscreteAccessory": { @@ -1223,7 +1223,7 @@ "attributes": { "PredefinedType": "Predefined types of distribution chambers." }, - "description": "Predefined types of distribution chambers.", + "description": "The element type IfcDistributionChamberElementType defines a list of commonly shared property set definitions of a distribution chamber element and an optional set of product representations. It is used to define a distribution chamber element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcdistributionchamberelementtype.htm" }, "IfcDistributionControlElement": { @@ -1231,7 +1231,7 @@ "AssignedToFlowElement": "Reference through the relationship object to related distribution flow elements.", "ControlElementId": "The ControlElement Point Identification assigned to this control element by the Building Automation System." }, - "description": "Reference through the relationship object to related distribution flow elements.", + "description": "The distribution element IfcDistributionControlElement defines occurrence elements of a building automation control system that are used to impart control over elements of a distribution system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcdistributioncontrolelement.htm" }, "IfcDistributionControlElementType": { @@ -1250,7 +1250,7 @@ "attributes": { "HasControlElements": "Reference to the relationship object that relates control elements." }, - "description": "Reference to the relationship object that relates control elements.", + "description": "The distribution element IfcDistributionFlowElement defines occurrence elements of a distribution system that facilitate the distribution of energy or matter, such as air, water or power.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcdistributionflowelement.htm" }, "IfcDistributionFlowElementType": { @@ -1261,7 +1261,7 @@ "attributes": { "FlowDirection": "Enumeration that identifies if this port is a Sink (inlet), a Source (outlet) or both a SinkAndSource." }, - "description": "Enumeration that identifies if this port is a Sink (inlet), a Source (outlet) or both a SinkAndSource.", + "description": "The product IfcDistributionPort defines the occurrence of a specialized port for use within the context of distribution elements. Its type is defined by IfcDistributionPortType or its subtypes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcdistributionport.htm" }, "IfcDocumentElectronicFormat": { @@ -1270,7 +1270,7 @@ "MimeContentType": "Main Mime type (as published by W3C or as user defined application type)", "MimeSubtype": "Mime subtype information." }, - "description": "Mime subtype information.", + "description": "An IfcDocumentElectronicFormat captures the type of document being referenced as an external source,and for which metadata is specified by IfcDocumentInformation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcdocumentelectronicformat.htm" }, "IfcDocumentInformation": { @@ -1295,7 +1295,7 @@ "ValidFrom": "Date, when the document becomes valid.", "ValidUntil": "Date until which the document remains valid." }, - "description": "An inverse relationship from the IfcDocumentInformationRelationship to the relating document.", + "description": "An IfcDocumentInformation captures \"metadata\" of an external document. The actual content of the document is not defined in IFC ; instead, it can be found following the reference given to IfcDocumentReference.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcdocumentinformation.htm" }, "IfcDocumentInformationRelationship": { @@ -1304,22 +1304,22 @@ "RelatingDocument": "The document that acts as the parent, referencing or original document in a relationship.", "RelationshipType": "Describes the type of relationship between documents. This could be sub-document, replacement etc. The interpretation has to be established in an application context." }, - "description": "Describes the type of relationship between documents. This could be sub-document, replacement etc. The interpretation has to be established in an application context.", + "description": "An IfcDocumentInformationRelationship is a relationship class that enables a document to have the ability to reference other documents.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcdocumentinformationrelationship.htm" }, "IfcDocumentReference": { "attributes": { "ReferenceToDocument": "The document information that is being referenced." }, - "description": "The document information that is being referenced.", + "description": "An IfcDocumentReference is a reference to the location of a document. The reference is given by a system interpretable Location attribute (e.g., an URL string) or by a human readable location, where the document can be found, and an optional inherited internal reference ItemReference, which refers to a system interpretable position within the document. The optional inherited Name attribute is meant to have meaning for human readers. Optional document metadata can also be captured through reference to IfcDocumentInformation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcdocumentreference.htm" }, "IfcDoor": { "attributes": { - "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE  The body of the door might be taller then the door opening (e.g. in cases where the door lining includes a casing). In these cases the OverallHeight shall still be given as the door opening height, and not as the total height of the door lining.", - "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE  The body of the door might be wider then the door opening (e.g. in cases where the door lining includes a casing). In these cases the OverallWidth shall still be given as the door opening width, and not as the total width of the door lining." + "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE The body of the door might be taller then the door opening (e.g. in cases where the door lining includes a casing). In these cases the OverallHeight shall still be given as the door opening height, and not as the total height of the door lining.", + "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE The body of the door might be wider then the door opening (e.g. in cases where the door lining includes a casing). In these cases the OverallWidth shall still be given as the door opening width, and not as the total width of the door lining." }, - "description": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE  The body of the door might be wider then the door opening (e.g. in cases where the door lining includes a casing). In these cases the OverallWidth shall still be given as the door opening width, and not as the total width of the door lining.", + "description": "Definition from ISO 6707-1:1989: Construction for closing an opening, intended primarily for access with hinged, pivoted or sliding operation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcdoor.htm" }, "IfcDoorLiningProperties": { @@ -1336,7 +1336,7 @@ "TransomOffset": "Offset of the transom (if given) which divides the door leaf from a glazing (or window) above. The offset is given from the bottom of the door opening.", "TransomThickness": "Thickness (width in plane parallel to door leaf) of the transom (if given) which divides the door leaf from a glazing (or window) above." }, - "description": "Pointer to the shape aspect, if given. The shape aspect reflects the part of the door shape, which represents the door lining.", + "description": "Definition of IAI: The door lining is the frame which enables the door leaf to be fixed in position. The door lining is used to hang the door leaf. The parameters of the door lining (IfcDoorLiningProperties) define the geometrically relevant parameter of the lining.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcdoorliningproperties.htm" }, "IfcDoorPanelProperties": { @@ -1347,7 +1347,7 @@ "PanelWidth": "Width of this panel, given as ratio relative to the total clear opening width of the door.", "ShapeAspectStyle": "Pointer to the shape aspect, if given. The shape aspect reflects the part of the door shape, which represents the door panel." }, - "description": "Pointer to the shape aspect, if given. The shape aspect reflects the part of the door shape, which represents the door panel.", + "description": "A description of the door panel. A door panel is normally a door leaf that opens to allow people or goods to pass. The parameters of the door panel define the geometrically relevant parameter of the panel,", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcdoorpanelproperties.htm" }, "IfcDoorStyle": { @@ -1357,7 +1357,7 @@ "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value.", "Sizeable": "The Boolean indicates, whether the attached _IfcMappedRepresentation_ (if given) can be sized (using scale factor of transformation), or not (FALSE). If not, the _IfcMappedRepresentation_ should be _IfcShapeRepresentation_ of the _IfcDoor_ (using _IfcMappedItem_ as the _Item_) with the scale factor = 1." }, - "description": "The Boolean indicates, whether the attached _IfcMappedRepresentation_ (if given) can be sized (using scale factor of transformation), or not (FALSE). If not, the _IfcMappedRepresentation_ should be _IfcShapeRepresentation_ of the _IfcDoor_ (using _IfcMappedItem_ as the _Item_) with the scale factor = 1.", + "description": "Definition from IAI: The door style, IfcDoorStyle, defines a particular style of doors, which may be included into the spatial context of the building model through an (or multiple) instances of IfcDoor. A door style defines the overall parameter of the door style and refers to the particular parameter of the lining and one (or several) panels through the IfcDoorLiningProperties and the IfcDoorPanelProperties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcdoorstyle.htm" }, "IfcDraughtingCallout": { @@ -1366,7 +1366,7 @@ "IsRelatedFromCallout": "", "IsRelatedToCallout": "" }, - "description": "", + "description": "A draughting callout is a collection of annotated curves, symbols and text that presents some product shape or definition properties within a drawing.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdimensioningresource/lexical/ifcdraughtingcallout.htm" }, "IfcDraughtingCalloutRelationship": { @@ -1376,7 +1376,7 @@ "RelatedDraughtingCallout": "The other of the draughting callouts which is a part of the relationship.", "RelatingDraughtingCallout": "One of the draughting callouts which is a part of the relationship." }, - "description": "The other of the draughting callouts which is a part of the relationship.", + "description": "The draughting callout relationship establishes a logical relationship between two draughting callouts. The meaning of this relationship is given at the subtypes of this entity.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdimensioningresource/lexical/ifcdraughtingcalloutrelationship.htm" }, "IfcDraughtingPreDefinedColour": { @@ -1395,21 +1395,21 @@ "attributes": { "PredefinedType": "The type of duct fitting." }, - "description": "The type of duct fitting.", + "description": "The element type IfcDuctFittingType defines a list of commonly shared property set definitions of a duct fitting and an optional set of product representations. It is used to define an duct fitting specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcductfittingtype.htm" }, "IfcDuctSegmentType": { "attributes": { "PredefinedType": "The type of duct segment." }, - "description": "The type of duct segment.", + "description": "The element type IfcDuctSegmentType defines a list of commonly shared property set definitions of a duct segment and an optional set of product representations. It is used to define a duct segment specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcductsegmenttype.htm" }, "IfcDuctSilencerType": { "attributes": { "PredefinedType": "The type of duct silencer." }, - "description": "The type of duct silencer.", + "description": "The element type IfcDuctSilencerType defines a list of commonly shared property set definitions of a duct silencer and an optional set of product representations. It is used to define a duct silencer specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcductsilencertype.htm" }, "IfcEdge": { @@ -1417,7 +1417,7 @@ "EdgeEnd": "End point (vertex) of the edge. The same vertex can be used for both EdgeStart and EdgeEnd.", "EdgeStart": "Start point (vertex) of the edge." }, - "description": "End point (vertex) of the edge. The same vertex can be used for both EdgeStart and EdgeEnd.", + "description": "Definition from ISO/CD 10303-42:1992: An edge is the topological construct corresponding to the connection of two vertices. More abstractly, it may stand for a logical relationship between two vertices. The domain of an edge, if present, is a finite, non-self-intersecting open curve in R^M^, that is, a connected 1-dimensional manifold. The bounds of an edge are two vertices, which need not be distinct. The edge is oriented by choosing its traversal direction to run from the first to the second vertex. If the two vertices are the same, the edge is a self loop. The domain of the edge does not include its bounds, and 0 \u2264 \u039e \u2264 \u221e. Associated with an edge may be a geometric curve to locate the edge in a coordinate space; this is represented by the edge curve (IfcEdgeCurve) subtype. The curve shall be finite and non-self-intersecting within the domain of the edge. An edge is a graph, so its multiplicity M and graph genus G^e^ may be determined by the graph traversal algorithm. Since M = E = 1, the Euler equation (1) reduces in the case to", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcedge.htm" }, "IfcEdgeCurve": { @@ -1425,14 +1425,14 @@ "EdgeGeometry": "The curve which defines the shape and spatial location of the edge. This curve may be unbounded and is implicitly trimmed by the vertices of the edge; this defines the edge domain. Multiple edges can reference the same curve.", "SameSense": "This logical flag indicates whether (TRUE), or not (FALSE) the senses of the edge and the curve defining the edge geometry are the same. The sense of an edge is from the edge start vertex to the edge end vertex; the sense of a curve is in the direction of increasing parameter." }, - "description": "This logical flag indicates whether (TRUE), or not (FALSE) the senses of the edge and the curve defining the edge geometry are the same. The sense of an edge is from the edge start vertex to the edge end vertex; the sense of a curve is in the direction of increasing parameter.", + "description": "Definition from ISO/CD 10303-42:1992: An edge curve is a special subtype of edge which has its geometry fully defined. The geometry is defined by associating the edge with a curve which may be unbounded. As the topological and geometric directions may be opposed, an indicator (same sense) is used to identify whether the edge and curve directions agree or are opposed. The Boolean value indicates whether the curve direction agrees with (TRUE) or is in the opposite direction (FALSE) to the edge direction. Any geometry associated with the vertices of the edge shall be consistent with the edge geometry.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcedgecurve.htm" }, "IfcEdgeFeature": { "attributes": { "FeatureLength": "The length of the feature in orthogonal direction from the feature cross section." }, - "description": "The length of the feature in orthogonal direction from the feature cross section.", + "description": "A feature describing the edge shape of an building element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedcomponentelements/lexical/ifcedgefeature.htm" }, "IfcEdgeLoop": { @@ -1440,14 +1440,14 @@ "EdgeList": "A list of oriented edge entities which are concatenated together to form this path.", "Ne": "The number of elements in the edge list. SIZEOF(EdgeList)" }, - "description": "The number of elements in the edge list. SIZEOF(EdgeList)", + "description": "Definition from ISO/CD 10303-42:1992: An edge_loop is a loop with nonzero extent. It is a path in which the start and end vertices are the same. Its domain, if present, is a closed curve. An edge_loop may overlap itself.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcedgeloop.htm" }, "IfcElectricApplianceType": { "attributes": { "PredefinedType": "Identifies the predefined types of electrical appliance from which the type required may be set." }, - "description": "Identifies the predefined types of electrical appliance from which the type required may be set.", + "description": "An IfcElectricApplianceType defines a particular type of common electrical appliance found in a typical AEC/FM facility. Electrical Appliances generally consist of electrical devices that are not a fixed part of the building but instead can be moved from one space to another and are powered with electricity.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricappliancetype.htm" }, "IfcElectricDistributionPoint": { @@ -1455,42 +1455,42 @@ "DistributionPointFunction": "Identifies the functions or purposes that a distribution point may fulfill from which that required may be selected.", "UserDefinedFunction": "" }, - "description": "", + "description": "An IfcElectricDistributionPoint is a flow controller in which instances of electrical devices are brought together at a single place for a particular purpose", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricdistributionpoint.htm" }, "IfcElectricFlowStorageDeviceType": { "attributes": { "PredefinedType": "" }, - "description": "", + "description": "An IfcElectricFlowStorageDeviceType is a device in which electrical energy is stored and from which energy may be progressively released.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricflowstoragedevicetype.htm" }, "IfcElectricGeneratorType": { "attributes": { "PredefinedType": "Identifies the predefined types of electric generators from which the type required may be set." }, - "description": "Identifies the predefined types of electric generators from which the type required may be set.", + "description": "An IfcElectricGeneratorType defines a particular type of engine that is a machine for converting mechanical energy into electrical energy.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricgeneratortype.htm" }, "IfcElectricHeaterType": { "attributes": { "PredefinedType": "Identifies the predefined types of electric heater from which the type required may be set." }, - "description": "Identifies the predefined types of electric heater from which the type required may be set.", + "description": "An IfcElectricHeaterType is a device that emits electrical energy as heat.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricheatertype.htm" }, "IfcElectricMotorType": { "attributes": { "PredefinedType": "Identifies the predefined types of electric motor from which the type required may be set." }, - "description": "Identifies the predefined types of electric motor from which the type required may be set.", + "description": "Definition from BS6100 310 5201: An IfcElectricMotorType defines a particular type of engine that is a machine for converting electrical energy into mechanical energy.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectricmotortype.htm" }, "IfcElectricTimeControlType": { "attributes": { "PredefinedType": "Identifies the predefined types of electrical time control from which the type required may be set." }, - "description": "Identifies the predefined types of electrical time control from which the type required may be set.", + "description": "An IfcElectricTimeControlType is a device that applies control to the provision or flow of electrical energy over time.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcelectrictimecontroltype.htm" }, "IfcElectricalBaseProperties": { @@ -1504,7 +1504,7 @@ "MinimumCircuitCurrent": "Minimum current carrying capacity of the electrical circuit.", "RatedPowerInput": "Actual electrical input power of the electrical device at its rated capacity" }, - "description": "Relative phase of input conductors", + "description": "Common definition to capture basic electrical characteristics for use in building services and facilities management.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcelectricalbaseproperties.htm" }, "IfcElectricalCircuit": { @@ -1528,10 +1528,10 @@ "HasStructuralMember": "", "IsConnectionRealization": "Reference to the connection relationship with realizing element. The relationship then refers to the realizing element which provides the physical manifestation of the connection relationship.", "ProvidesBoundaries": "Reference to Space Boundaries by virtue of the objectified relationship IfcRelSeparatesSpaces. It defines the concept of an Building Element bounding Spaces.", - "ReferencedInStructures": "Reference relationship to the spatial structure element, to which the element is additionally associated. > IFC2x Edition 3 CHANGE  The inverse attribute has been added with upward compatibility for file based exchange. ", + "ReferencedInStructures": "Reference relationship to the spatial structure element, to which the element is additionally associated.", "Tag": "The tag (or label) identifier at the particular instance of a product, e.g. the serial number, or the position number. It is the identifier at the occurrence level." }, - "description": "Containment relationship to the spatial structure element, to which the element is primarily associated.", + "description": "Generalization of all components that make up an AEC product. Those elements can be logically contained by a spatial structure element that constitutes a certain level within a project structure hierarchy (e.g., site, building, storey or space). This is done by using the IfcRelContainedInSpatialStructure relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcelement.htm" }, "IfcElementAssembly": { @@ -1539,7 +1539,7 @@ "AssemblyPlace": "A designation of where the assembly is intended to take place defined by an Enum.", "PredefinedType": "Predefined generic types for a element assembly that are specified in an enumeration." }, - "description": "Predefined generic types for a element assembly that are specified in an enumeration.", + "description": "A container class that represents complex element assemblies aggregated from several elements, such as discrete elements, building elements, or other elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcelementassembly.htm" }, "IfcElementComponent": { @@ -1552,17 +1552,17 @@ }, "IfcElementQuantity": { "attributes": { - "MethodOfMeasurement": "Name of the method of measurement used to calculate the element quantity. The method of measurement attribute has to be made recognizable by further agreements. > IFC2x2 Addendum 1 change: The attribute has been changed to be optional ", + "MethodOfMeasurement": "Name of the method of measurement used to calculate the element quantity. The method of measurement attribute has to be made recognizable by further agreements.", "Quantities": "The individual quantities for the element, can be a set of length, area, volume, weight or count based quantities." }, - "description": "The individual quantities for the element, can be a set of length, area, volume, weight or count based quantities.", + "description": "An IfcElementQuantity defines a set of derived measures of an element's physical property. Elements could be spatial structure elements (like buildings, storeys, or spaces) or building elements (like walls, slabs, finishes). The IfcElementQuantity gets assigned to the element by using the IfcRelDefinesByProperties relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcelementquantity.htm" }, "IfcElementType": { "attributes": { "ElementType": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED." }, - "description": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED.", + "description": "The IfcElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcelementtype.htm" }, "IfcElementarySurface": { @@ -1570,7 +1570,7 @@ "Dim": "The space dimensionality of this class, derived from the dimensionality of the Position. Position.Dim", "Position": "The position and orientation of the surface. This attribute is used in the definition of the parameterization of the surface." }, - "description": "The space dimensionality of this class, derived from the dimensionality of the Position. Position.Dim", + "description": "Definition from ISO/CD 10303-42:1992: An elementary surface (IfcElementarySurface) is a simple analytic surface with defined parametric representation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcelementarysurface.htm" }, "IfcEllipse": { @@ -1578,7 +1578,7 @@ "SemiAxis1": "The first radius of the ellipse which shall be positive. Placement.Axes[1] gives the direction of the SemiAxis1.", "SemiAxis2": "The second radius of the ellipse which shall be positive." }, - "description": "The second radius of the ellipse which shall be positive.", + "description": "Definition from ISO/CD 10303-42:1992: An ellipse (IfcEllipse) is a conic section defined by the lengths of the semi-major and semi-minor diameters and the position (center or mid point of the line joining the foci) and orientation of the curve. Interpretation of the data shall be as follows:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcellipse.htm" }, "IfcEllipseProfileDef": { @@ -1586,7 +1586,7 @@ "SemiAxis1": "The first radius of the ellipse. It is measured along the direction of Position.P[1].", "SemiAxis2": "The second radius of the ellipse. It is measured along the direction of Position.P[2]." }, - "description": "The second radius of the ellipse. It is measured along the direction of Position.P[2].", + "description": "Definition from IAI: The IfcEllipseProfileDef defines an ellipse as the profile definition used by the swept surface geometry or the swept area solid. It is given by its semi axis attributes and placed within the 2D position coordinate system, established by the Position attribute.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcellipseprofiledef.htm" }, "IfcEnergyConversionDevice": { @@ -1602,7 +1602,7 @@ "EnergySequence": "", "UserDefinedEnergySequence": "This attribute must be defined if the EnergySequence is USERDEFINED." }, - "description": "This attribute must be defined if the EnergySequence is USERDEFINED.", + "description": "Common definition to capture the properties of an energy source typically used within the context of building services.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcenergyproperties.htm" }, "IfcEnvironmentalImpactValue": { @@ -1611,7 +1611,7 @@ "ImpactType": "Specification of the environmental impact type to be referenced.", "UserDefinedCategory": "A user defined value category into which the environmental impact value falls." }, - "description": "A user defined value category into which the environmental impact value falls.", + "description": "An IfcEnvironmentalImpactValue is an amount or measure of an environmental impact or a value that affects an amount or measure of an environmental impact.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifcenvironmentalimpactvalue.htm" }, "IfcEquipmentElement": { @@ -1626,14 +1626,14 @@ "attributes": { "PredefinedType": "Defines the type of evaporative cooler." }, - "description": "Defines the type of evaporative cooler.", + "description": "The element type IfcEvaporativeCoolerType defines a list of commonly shared property set definitions of an evaporative cooler and an optional set of product representations. It is used to define an evaporative cooler specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcevaporativecoolertype.htm" }, "IfcEvaporatorType": { "attributes": { "PredefinedType": "Defines the type of evaporator." }, - "description": "Defines the type of evaporator.", + "description": "The element type IfcEvaporatorType defines a list of commonly shared property set definitions of an evaporator and an optional set of product representations. It is used to define an evaporator specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcevaporatortype.htm" }, "IfcExtendedMaterialProperties": { @@ -1642,7 +1642,7 @@ "ExtendedProperties": "The set of material properties defined by user for this material.", "Name": "The name given to the set of extended properties." }, - "description": "The name given to the set of extended properties.", + "description": "A container class for user defined properties of associated material. This provides a mechanism to assign properties that have not been defined in IFC specification.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcextendedmaterialproperties.htm" }, "IfcExternalReference": { @@ -1651,7 +1651,7 @@ "Location": "Location, where the external source (classification, document or library). This can be either human readable or computer interpretable. For electronic location normally given as an URL location string, however other ways of accessing external references may be established in an application scenario.", "Name": "Optional name to further specify the reference. It can provide a human readable identifier (which does not necessarily need to have a counterpart in the internal structure of the document)." }, - "description": "Optional name to further specify the reference. It can provide a human readable identifier (which does not necessarily need to have a counterpart in the internal structure of the document).", + "description": "An IfcExternalReference is the identification of information that is not explicitly represented in the current model or in the project database (as an implementation of the current model). Such information may be contained in classifications, documents or libraries.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifcexternalreference.htm" }, "IfcExternallyDefinedHatchStyle": { @@ -1675,14 +1675,14 @@ "Depth": "The distance the surface is to be swept.", "ExtrudedDirection": "The direction in which the surface is to be swept." }, - "description": "The distance the surface is to be swept.", + "description": "The extruded area solid (IfcExtrudedAreaSolid) is defined by sweeping a bounded planar surface. The direction of the extrusion is given by the ExtrudedDirection attribute and the length of the extrusion is given by the Depth attribute. If the planar area has inner boundaries, i.e. holes defined, then those holes shall be swept into holes of the solid.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcextrudedareasolid.htm" }, "IfcFace": { "attributes": { "Bounds": "Boundaries of the face." }, - "description": "Boundaries of the face.", + "description": "Definition from ISO/CD 10303-42:1992: A face is a topological entity of dimensionality 2 corresponding to the intuitive notion of a piece of surface bounded by loops. Its domain, if present, is an oriented, connected, finite 2-manifold in R^m^. A face domain shall not have handles but it may have holes, each hole bounded by a loop. The domain of the underlying geometry of the face, if present, does not contain its bounds, and 0 < \u039e < \u221e.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcface.htm" }, "IfcFaceBasedSurfaceModel": { @@ -1690,7 +1690,7 @@ "Dim": "The space dimensionality of this class, it is always 3. 3", "FbsmFaces": "The set of connected face sets comprising the face based surface model." }, - "description": "The space dimensionality of this class, it is always 3. 3", + "description": "Definition from ISO/CD 10303-42:1992: A face based surface model is described by a set of connected face sets of dimensionality 2. The connected face sets shall not intersect except at edges and vertices, except that a face in one connected face set may overlap a face in another connected face set, provided the face boundaries are identical. There shall be at least one connected face set.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcfacebasedsurfacemodel.htm" }, "IfcFaceBound": { @@ -1698,7 +1698,7 @@ "Bound": "The loop which will be used as a face boundary.", "Orientation": "This indicated whether (TRUE) or not (FALSE) the loop has the same sense when used to bound the face as when first defined. If sense is FALSE the senses of all its component oriented edges are implicitly reversed when used in the face." }, - "description": "This indicated whether (TRUE) or not (FALSE) the loop has the same sense when used to bound the face as when first defined. If sense is FALSE the senses of all its component oriented edges are implicitly reversed when used in the face.", + "description": "Definition from ISO/CD 10303-42:1992: A face bound is a loop which is intended to be used for bounding a face.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcfacebound.htm" }, "IfcFaceOuterBound": { @@ -1710,7 +1710,7 @@ "FaceSurface": "The surface which defines the internal shape of the face. This surface may be unbounded. The domain of the face is defined by this surface and the bounding loops in the inherited attribute SELF\\FaceBounds.", "SameSense": "This flag indicates whether the sense of the surface normal agrees with (TRUE), or opposes (FALSE), the sense of the topological normal to the face." }, - "description": "This flag indicates whether the sense of the surface normal agrees with (TRUE), or opposes (FALSE), the sense of the topological normal to the face.", + "description": "Definition from ISO/CD 10303-42:1992: A face surface (IfcFaceSurface) is a subtype of face in which the geometry is defined by an associated surface. The portion of the surface used by the face shall be embeddable in the plane as an open disk, possibly with holes. However, the union of the face with the edges and vertices of its bounding loops need not be embeddable in the plane. It may, for example, cover an entire sphere or torus. As both a face and a geometric surface have defined normal directions, a BOOLEAN flag (the orientation attribute) is used to indicate whether the surface normal agrees with (TRUE) or is opposed to (FALSE) the face normal direction. The geometry associated with any component of the loops of the face shall be consistent with the surface geometry, in the sense that the domains of all the vertex points and edge curves are contained in the face geometry surface. A surface may be referenced by more than one face surface.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcfacesurface.htm" }, "IfcFacetedBrep": { @@ -1721,7 +1721,7 @@ "attributes": { "Voids": "Set of closed shells defining voids within the solid." }, - "description": "Set of closed shells defining voids within the solid.", + "description": "The IfcFacetedBrepWithVoids is a specialization of a faceted B-rep which contains one or more voids in its interior. The voids are represented as closed shells which are defined so that the shell normal point into the void.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcfacetedbrepwithvoids.htm" }, "IfcFailureConnectionCondition": { @@ -1733,14 +1733,14 @@ "TensionFailureY": "Tension force in y-direction leading to failure of the connection.", "TensionFailureZ": "Tension force in z-direction leading to failure of the connection." }, - "description": "Compression force in z-direction leading to failure of the connection.", + "description": "Instances of the entity IfcFailureConnectionCondition shall be used to describe connection properties needed to specify the failure of a connection.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcfailureconnectioncondition.htm" }, "IfcFanType": { "attributes": { "PredefinedType": "Defines the type of fan typically used in building services." }, - "description": "Defines the type of fan typically used in building services.", + "description": "The element type IfcFanType defines a list of commonly shared property set definitions of a fan and an optional set of product representations. It is used to define a fan specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcfantype.htm" }, "IfcFastener": { @@ -1759,39 +1759,39 @@ "attributes": { "ProjectsElements": "Reference to the _IfcRelProjectsElement_ relationship that uses this _IfcFeatureElementAddition_ to create a volume addition at an element. The _IfcFeatureElementAddition_ can only be used to create a single addition at a single element using Boolean addition operation." }, - "description": "Reference to the _IfcRelProjectsElement_ relationship that uses this _IfcFeatureElementAddition_ to create a volume addition at an element. The _IfcFeatureElementAddition_ can only be used to create a single addition at a single element using Boolean addition operation.", + "description": "A specialization of the general feature element, that represents an existence dependent element which modifies the shape and appearance of the associated master element. The IfcFeatureElementAddition offers the ability to handle shape modifiers as semantic objects within the IFC object model that add to the shape of the master element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcfeatureelementaddition.htm" }, "IfcFeatureElementSubtraction": { "attributes": { "VoidsElements": "Reference to the Voids Relationship that uses this Opening Element to create a void within an Element. The Opening Element can only be used to create a single void within a single Element." }, - "description": "Reference to the Voids Relationship that uses this Opening Element to create a void within an Element. The Opening Element can only be used to create a single void within a single Element.", + "description": "A specialization of the general feature element, that represents an existence dependent elements which modifies the shape and appearance of the associated master element. The IfcFeatureElementSubtraction offers the ability to handle shape modifiers as semantic objects within the IFC object model that subtract from the shape of the master element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcfeatureelementsubtraction.htm" }, "IfcFillAreaStyle": { "attributes": { "FillStyles": "The set of fill area styles to use in presenting visible curve segments, annotation fill areas or surfaces." }, - "description": "The set of fill area styles to use in presenting visible curve segments, annotation fill areas or surfaces.", + "description": "Definition from ISO/CD 10303-46:1992: The style for filling visible curve segments, annotation fill areas or surfaces with tiles or hatches.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcfillareastyle.htm" }, "IfcFillAreaStyleHatching": { "attributes": { "HatchLineAngle": "A plane angle measure determining the direction of the parallel hatching lines.", "HatchLineAppearance": "The curve style of the hatching lines. Any curve style pattern shall start at the origin of each hatch line.", - "PatternStart": "A distance along the reference hatch line which is the start point for the curve style font pattern of the reference hatch line. If not given, the start point of the curve style font pattern is at the (virtual) hatching coordinate system. > IFC2x Edition 2 Addendum 2 CHANGE The attribute PatternStart has been made OPTIONAL.", - "PointOfReferenceHatchLine": "A Cartesian point which defines the offset of the reference hatch line from the origin of the (virtual) hatching coordinate system. The origin is used for mapping the fill area style hatching onto an annotation fill area or surface. The reference hatch line would then appear with this offset from the fill style target point. If not given the reference hatch lines goes through the origin of the (virtual) hatching coordinate system. > IFC2x Edition 3 CHANGE  The usage of the attribute PointOfReferenceHatchLine has changed to not provide the Cartesian point which is the origin for mapping, but to provide an offset to the origin for the mapping. The attribute has been made OPTIONAL. ", - "StartOfNextHatchLine": "A repetition factor that determines the distance between adjacent hatch lines. > IFC2x Edition 3 CHANGE  The attribute type of StartOfNextHatchLine has changed to a SELECT of IfcPositiveLengthMeasure (new) and IfcOneDirectionRepeatFactor." + "PatternStart": "A distance along the reference hatch line which is the start point for the curve style font pattern of the reference hatch line. If not given, the start point of the curve style font pattern is at the (virtual) hatching coordinate system.", + "PointOfReferenceHatchLine": "A Cartesian point which defines the offset of the reference hatch line from the origin of the (virtual) hatching coordinate system. The origin is used for mapping the fill area style hatching onto an annotation fill area or surface. The reference hatch line would then appear with this offset from the fill style target point. If not given the reference hatch lines goes through the origin of the (virtual) hatching coordinate system.", + "StartOfNextHatchLine": "A repetition factor that determines the distance between adjacent hatch lines." }, - "description": "A plane angle measure determining the direction of the parallel hatching lines.", + "description": "Definition from ISO/CD 10303-46:1992: The fill area style hatching defines a styled pattern of curves for hatching an annotation fill area or a surface.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcfillareastylehatching.htm" }, "IfcFillAreaStyleTileSymbolWithStyle": { "attributes": { "Symbol": "A styled annotation symbol." }, - "description": "A styled annotation symbol.", + "description": "The fill area style tile symbol with style is a symbol that is used as a tile within an annotated tiling.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcfillareastyletilesymbolwithstyle.htm" }, "IfcFillAreaStyleTiles": { @@ -1800,21 +1800,21 @@ "TilingPattern": "A two direction repeat factor defining the shape and relative positioning of the tiles.", "TilingScale": "The scale factor applied to each tile as it is placed in the annotation fill area." }, - "description": "The scale factor applied to each tile as it is placed in the annotation fill area.", + "description": "Definition from ISO/CD 10303-46:1992: The fill area style tiles defines a two dimensional tile to be used for the filling of annotation fill areas or other closed regions. The content of a tile is defined by the tile set, and the placement of each tile determined by the filling pattern which indicates how to place tiles next to each other. Tiles or parts of tiles outside of the annotation fill area or closed region shall be clipped at the boundaries of the area or region.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcfillareastyletiles.htm" }, "IfcFilterType": { "attributes": { "PredefinedType": "The type of air filter." }, - "description": "The type of air filter.", + "description": "The element type IfcFilterType defines a list of commonly shared property set definitions of a filter and an optional set of product representations. It is used to define a filter specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcfiltertype.htm" }, "IfcFireSuppressionTerminalType": { "attributes": { "PredefinedType": "Identifies the predefined types of fire suppression terminal from which the type required may be set." }, - "description": "Identifies the predefined types of fire suppression terminal from which the type required may be set.", + "description": "The IfcFireSuppressionTerminalType defines a particular type of IfcFlowTerminal that has the purpose of delivering a fluid (gas or liquid) that will suppress a fire.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcplumbingfireprotectiondomain/lexical/ifcfiresuppressionterminaltype.htm" }, "IfcFlowController": { @@ -1837,14 +1837,14 @@ "attributes": { "PredefinedType": "Identifies the predefined types of flow instrument from which the type required may be set." }, - "description": "Identifies the predefined types of flow instrument from which the type required may be set.", + "description": "An IfcFlowInstrumentType defines a particular type of flow instrument that reads and displays the value of a particular property of a system at a point, or that displays the difference in the value of a property between two points.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcbuildingcontrolsdomain/lexical/ifcflowinstrumenttype.htm" }, "IfcFlowMeterType": { "attributes": { "PredefinedType": "Defines the type of flow meter." }, - "description": "Defines the type of flow meter.", + "description": "The element type IfcFlowMeterType defines a list of commonly shared property set definitions of a flow meter and an optional set of product representations. It is used to define a flow meter specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcflowmetertype.htm" }, "IfcFlowMovingDevice": { @@ -1905,14 +1905,14 @@ "WetBulbTemperatureSingleValue": "Wet bulb temperature of the fluid; only applicable if the fluid is air.", "WetBulbTemperatureTimeSeries": "Time series of fluid wet bulb temperature values. These values are only applicable if the fluid is air." }, - "description": "The pressure of the fluid.", + "description": "Common definition to capture the basic flow properties of a fluid typically used within a flow distribution system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcfluidflowproperties.htm" }, "IfcFooting": { "attributes": { "PredefinedType": "The generic type of the footing." }, - "description": "The generic type of the footing.", + "description": "A part of the foundation of a structure that spreads and transmits the load directly to the soil.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcfooting.htm" }, "IfcFuelProperties": { @@ -1922,7 +1922,7 @@ "HigherHeatingValue": "Higher Heating Value is defined as the amount of energy released (MJ/kg) when a fuel is burned completely, and H2O is in liquid form in the combustion products.", "LowerHeatingValue": "Lower Heating Value is defined as the amount of energy released (MJ/kg) when a fuel is burned completely, and H2O is in vapor form in the combustion products." }, - "description": "Higher Heating Value is defined as the amount of energy released (MJ/kg) when a fuel is burned completely, and H2O is in liquid form in the combustion products.", + "description": "Common definition to capture the properties of fuel energy typically used within the context of building services and flow distribution systems.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcfuelproperties.htm" }, "IfcFurnishingElement": { @@ -1941,14 +1941,14 @@ "attributes": { "AssemblyPlace": "A designation of where the assembly is intended to take place defined by an Enum." }, - "description": "A designation of where the assembly is intended to take place defined by an Enum.", + "description": "An IfcFurnitureType defines a particular type of item of furniture such as a table, desk, chair, filing cabinet etc.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcfurnituretype.htm" }, "IfcGasTerminalType": { "attributes": { "PredefinedType": "" }, - "description": "", + "description": "The element type IfcGasTerminalType defines a list of commonly shared property set definitions of a gas terminal and an optional set of product representations. It is used to define a gas terminal specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcgasterminaltype.htm" }, "IfcGeneralMaterialProperties": { @@ -1957,7 +1957,7 @@ "MolecularWeight": "Molecular weight of material (typically gas), measured in g/mole.", "Porosity": "The void fraction of the total volume occupied by material (Vbr - Vnet)/Vbr [m3/m3]." }, - "description": "Material mass density, usually measured in [kg/m3].", + "description": "A container class with general material properties defined in IFC specification.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcgeneralmaterialproperties.htm" }, "IfcGeneralProfileProperties": { @@ -1968,7 +1968,7 @@ "Perimeter": "Perimeter of the profile for calculating the surface area. Usually measured in [mm].", "PhysicalWeight": "Weight of an imaginary steel beam per length, as for example given by the national standards\t for this profile. Usually measured in [kg/m]." }, - "description": "Cross sectional area of profile. Usually measured in [mm2].", + "description": "This is a collection of properties applicable to all linear structural members having a profile definition.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcgeneralprofileproperties.htm" }, "IfcGeometricCurveSet": { @@ -1978,12 +1978,12 @@ "IfcGeometricRepresentationContext": { "attributes": { "CoordinateSpaceDimension": "The integer dimension count of the coordinate space modeled in a geometric representation context.", - "HasSubContexts": "The set of _IfcGeometricRepresentationSubContexts_ that refer to this _IfcGeometricRepresentationContext_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", + "HasSubContexts": "The set of _IfcGeometricRepresentationSubContexts_ that refer to this _IfcGeometricRepresentationContext_.", "Precision": "Value of the model precision for geometric models. It is a double value (REAL), typically in 1E-5 to 1E-8 range, that indicates the tolerance under which two given points are still assumed to be identical. The value can be used e.g. to sets the maximum distance from an edge curve to the underlying face surface in brep models.", "TrueNorth": "Direction of the true north relative to the underlying coordinate system as established by the attribute _WorldCoordinateSystem_. It is given by a direction within the xy-plane of the underlying coordinate system. If not given, it defaults to the positive direction of the y-axis of the _WorldCoordinateSystem_.", - "WorldCoordinateSystem": "Establishment of the engineering coordinate system (often referred to as the world coordinate system in CAD) for all representation contexts used by the project. > Note  it can be used to provide better numeric stability if the placement of the building(s) is far away from the origin. In most cases however it would be set to origin: (0.,0.,0.) and directions x(1.,0.,0.), y(0.,1.,0.), z(0.,0.,1.). " + "WorldCoordinateSystem": "Establishment of the engineering coordinate system (often referred to as the world coordinate system in CAD) for all representation contexts used by the project. > Note it can be used to provide better numeric stability if the placement of the building(s) is far away from the origin. In most cases however it would be set to origin: (0.,0.,0.) and directions x(1.,0.,0.), y(0.,1.,0.), z(0.,0.,1.)." }, - "description": "The set of _IfcGeometricRepresentationSubContexts_ that refer to this _IfcGeometricRepresentationContext_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", + "description": "Definition from ISO/CD 10303-42:1992: A geometric representation context is a representation context in which the geometric representation items are geometrically founded. A geometric representation context is a distinct coordinate space, spatially unrelated to other coordinate spaces.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcgeometricrepresentationcontext.htm" }, "IfcGeometricRepresentationItem": { @@ -1995,13 +1995,13 @@ "CoordinateSpaceDimension": "ParentContext.CoordinateSpaceDimension", "ParentContext": "Parent context from which the sub context derives its world coordinate system, precision, space coordinate dimension and true north.", "Precision": "NVL(ParentContext.Precision,1.E-5)", - "TargetScale": "The target plot scale of the representation to which this representation context applies. > Scale indicates the target plot scale for the representation sub context, all annotation styles are given in plot dimensions according to this target plot scale.
If multiple instances of IfcGeometricRepresentationSubContext are given having the same TargetView value, the target plot scale applies up to the next smaller scale, or up to unlimited small scale.

Note: Scale 1:100 (given as 0.01 within TargetScale) is bigger then 1:200 (given as 0.005 within TargetScale). ", + "TargetScale": "The target plot scale of the representation to which this representation context applies. > Scale indicates the target plot scale for the representation sub context, all annotation styles are given in plot dimensions according to this target plot scale. If multiple instances of IfcGeometricRepresentationSubContext are given having the same TargetView value, the target plot scale applies up to the next smaller scale, or up to unlimited small scale. Note: Scale 1:100 (given as 0.01 within TargetScale) is bigger then 1:200 (given as 0.005 within TargetScale).", "TargetView": "Target view of the representation to which this representation context applies.", "TrueNorth": "NVL(ParentContext.TrueNorth,SELF.WorldCoordinateSystem.P[2])", "UserDefinedTargetView": "User defined target view, this attribute value shall be given, if the TargetView attribute is set to USERDEFINED.", "WorldCoordinateSystem": "ParentContext.WorldCoordinateSystem" }, - "description": "NVL(ParentContext.Precision,1.E-5)", + "description": "Definition from IAI: The IfcGeometricRepresentationSubContext defines the context that applies to several shape representations of a product being a sub context, sharing the WorldCoordinateSystem, CoordinateSpaceDimension, Precision and TrueNorth attributes with the parent IfcGeometricRepresentationContext.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcgeometricrepresentationsubcontext.htm" }, "IfcGeometricSet": { @@ -2009,30 +2009,30 @@ "Dim": "The space dimensionality of this class, it is identical to the first element in the set. A where rule ensures that all elements have the same dimensionality. Elements[1].Dim", "Elements": "The geometric elements which make up the geometric set, these may be points, curves or surfaces; but are required to be of the same coordinate space dimensionality." }, - "description": "The space dimensionality of this class, it is identical to the first element in the set. A where rule ensures that all elements have the same dimensionality. Elements[1].Dim", + "description": "Definition from ISO/CD 10303-42:1992: This entity is intended for the transfer of models when a topological structure is not available.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcgeometricset.htm" }, "IfcGrid": { "attributes": { - "ContainedInStructure": "Relationship to a spatial structure element, to which the grid is primarily associated. > IFC2x PLATFORM CHANGE  The inverse relationship has been added to IfcGrid with upward compatibility ", + "ContainedInStructure": "Relationship to a spatial structure element, to which the grid is primarily associated.", "UAxes": "List of grid axes defining the first row of grid lines.", "VAxes": "List of grid axes defining the second row of grid lines.", "WAxes": "List of grid axes defining the third row of grid lines. It may be given in the case of a triangular grid." }, - "description": "Relationship to a spatial structure element, to which the grid is primarily associated. > IFC2x PLATFORM CHANGE  The inverse relationship has been added to IfcGrid with upward compatibility ", + "description": "IfcGrid ia a planar design grid defined in 3D space used as an aid in locating structural and design elements. The position of the grid (ObjectPlacement) is defined by a 3D coordinate system (and thereby the design grid can be used in plan, section or in any position relative to the world coordinate system). The position can be relative to the object placement of other products or grids. The XY plane of the 3D coordinate system is used to place the grid axes, which are 2D curves (e.g., line, circle, trimmed curve, polyline, or composite curve).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcgrid.htm" }, "IfcGridAxis": { "attributes": { "AxisCurve": "Underlying curve which provides the geometry for this grid axis.", "AxisTag": "The tag or name for this grid axis.", - "HasIntersections": "The reference to a set of IFC2x3 CHANGE  New inverse attribute. ", - "PartOfU": "If provided, the _IfcGridAxis_ is part of the _UAxes_ of _IfcGrid_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", - "PartOfV": "If provided, the _IfcGridAxis_ is part of the _VAxes_ of _IfcGrid_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", - "PartOfW": "If provided, the _IfcGridAxis_ is part of the _WAxes_ of _IfcGrid_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", + "HasIntersections": "The reference to a set of", + "PartOfU": "If provided, the _IfcGridAxis_ is part of the _UAxes_ of _IfcGrid_.", + "PartOfV": "If provided, the _IfcGridAxis_ is part of the _VAxes_ of _IfcGrid_.", + "PartOfW": "If provided, the _IfcGridAxis_ is part of the _WAxes_ of _IfcGrid_.", "SameSense": "Defines whether the original sense of curve is used or whether it is reversed in the context of the grid axis." }, - "description": "The reference to a set of IFC2x3 CHANGE  New inverse attribute. ", + "description": "An individual axis, the IfcGridAxis, is defined in the context of a design grid. The axis definition is based on a curve of dimensionality 2. The grid axis is positioned within the XY plane of the position coordinate system defined by the IfcDesignGrid.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcgridaxis.htm" }, "IfcGridPlacement": { @@ -2040,14 +2040,14 @@ "PlacementLocation": "A constraint on one or both ends of the path for an ExtrudedSolid.", "PlacementRefDirection": "Reference to a second grid axis intersection, which defines the orientation of the grid placement." }, - "description": "Reference to a second grid axis intersection, which defines the orientation of the grid placement.", + "description": "The IfcGridPlacement provides a specialization of IfcObjectPlacement in which the placement and axis direction of the object coordinate system is defined by a reference to the design grid as defined in IfcGrid.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcgridplacement.htm" }, "IfcGroup": { "attributes": { "IsGroupedBy": "Contains the relationship that assigns the group members to the group object." }, - "description": "Contains the relationship that assigns the group members to the group object.", + "description": "The IfcGroup is an generalization of any arbitrary group. A group is a logical collection of objects. It does not have its own position, nor can it hold its own shape representation. Therefore a group is an aggregation under some non-geometrical / topological grouping aspects.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcgroup.htm" }, "IfcHalfSpaceSolid": { @@ -2056,21 +2056,21 @@ "BaseSurface": "Surface defining side of half space.", "Dim": "The space dimensionality of this class, it is always 3 3" }, - "description": "The space dimensionality of this class, it is always 3 3", + "description": "Definition from ISO/CD 10303-42:1992: A half space solid is defined by the half space which is the regular subset of the domain which lies on one side of an unbounded surface. The side of the surface which is in the half space is determined by the surface normal and the agreement flag. If the agreement flag is TRUE, then the subset is the one the normal points away from. If the agreement flag is FALSE, then the subset is the one the normal points into. For a valid half space solid the surface shall divide the domain into exactly two subsets. Also, within the domain the surface shall be manifold and all surface normals shall point into the same subset.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifchalfspacesolid.htm" }, "IfcHeatExchangerType": { "attributes": { "PredefinedType": "Defines the basic types of heat exchanger (e.g., plate, shell and tube, etc.)." }, - "description": "Defines the basic types of heat exchanger (e.g., plate, shell and tube, etc.).", + "description": "The element type IfcHeatExchangerType defines a list of commonly shared property set definitions of a heat exchanger and an optional set of product representations. It is used to define a heat exchanger specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcheatexchangertype.htm" }, "IfcHumidifierType": { "attributes": { "PredefinedType": "Defines the type of humidifier." }, - "description": "Defines the type of humidifier.", + "description": "The element type IfcHumidifierType defines a list of commonly shared property set definitions of a humidifier and an optional set of product representations. It is used to define a humidifier specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifchumidifiertype.htm" }, "IfcHygroscopicMaterialProperties": { @@ -2081,7 +2081,7 @@ "UpperVaporResistanceFactor": "The vapor permeability relationship of air/material (typically value > 1), measured in high relative humidity (typically in 95/50 % RH).", "VaporPermeability": "Usually measured in [kg/s m Pa]." }, - "description": "Usually measured in [m3/s].", + "description": "A container class with material hygroscopic properties defined in IFC specification.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifchygroscopicmaterialproperties.htm" }, "IfcIShapeProfileDef": { @@ -2092,14 +2092,14 @@ "OverallWidth": "Total extent of the width, defined parallel to the x axis of the position coordinate system.", "WebThickness": "Thickness of the web of the I-shape. The web is centred on the x-axis and the y-axis of the position coordinate system." }, - "description": "The fillet between the web and the flange, if not given, zero is assumed.", + "description": "Definition from IAI: The IfcIShapeProfileDef defines a section profile that provides the defining parameters of a symmetrical 'I' section to be used by the swept surface geometry or the swept area solid. The I-shape profile has values for its overall depth, width and its web and flange thickness. Additionally a fillet radius may be given. It represents a I-section that is symmetrical about its major and minor axes; and that has both top and bottom flanges being equal and centred on the web.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcishapeprofiledef.htm" }, "IfcImageTexture": { "attributes": { "UrlReference": "" }, - "description": "", + "description": "Definition from IAI: An IfcImageTexture provides a 2-dimensional distribution of the lighting parameters of a surface onto which it is mapped.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcimagetexture.htm" }, "IfcInventory": { @@ -2111,14 +2111,14 @@ "OriginalValue": "An estimate of the original cost value of the inventory.", "ResponsiblePersons": "Persons who are responsible for the inventory." }, - "description": "An estimate of the original cost value of the inventory.", + "description": "An IfcInventory is a list of items within an enterprise.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcinventory.htm" }, "IfcIrregularTimeSeries": { "attributes": { "Values": "The collection of time series values." }, - "description": "The collection of time series values.", + "description": "In an irregular time series, unpredictable bursts of data arrive at unspecified points in time, or most time stamps cannot be characterized by a repeating pattern.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifcirregulartimeseries.htm" }, "IfcIrregularTimeSeriesValue": { @@ -2126,20 +2126,20 @@ "ListValues": "A list of time-series values. At least one value is required.", "TimeStamp": "The specification of the time point." }, - "description": "A list of time-series values. At least one value is required.", + "description": "The IfcIrregularTimeSeriesValue describes a value (or set of values) at a particular time point.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifcirregulartimeseriesvalue.htm" }, "IfcJunctionBoxType": { "attributes": { "PredefinedType": "Identifies the predefined types of junction boxes from which the type required may be set." }, - "description": "Identifies the predefined types of junction boxes from which the type required may be set.", + "description": "An IfcJunctionBoxType defines a particular type of junction box which is a housing inside which cables from electrical components are connected electrically.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcjunctionboxtype.htm" }, "IfcLShapeProfileDef": { "attributes": { - "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", - "CentreOfGravityInY": "Location of centre of gravity along the Y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box.", + "CentreOfGravityInY": "Location of centre of gravity along the Y axis measured from the center of the bounding box.", "Depth": "Leg length, see illustration above (= h).", "EdgeRadius": "Edge radius according the above illustration (= r2). If it is not given, zero is assumed.", "FilletRadius": "Fillet radius according the above illustration (= r1). If it is not given, zero is assumed.", @@ -2147,21 +2147,21 @@ "Thickness": "Constant wall thickness of profile, see illustration above (= ts).", "Width": "Leg length, see illustration above (= b). If not given, the value of the Depth attribute is applied to Width." }, - "description": "Location of centre of gravity along the Y axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInY has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "Definition from IAI: The IfcLShapeProfileDef defines a section profile that provides the defining parameters of an L-shaped section (equilateral L profiles are also covered by this entity) to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The shorter leg has the same direction as the positive x-axis, the longer or equal leg the same as the positive y-axis. The centre of the position coordinate system is in the profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifclshapeprofiledef.htm" }, "IfcLaborResource": { "attributes": { "SkillSet": "The skill set required for this type of labor." }, - "description": "The skill set required for this type of labor.", + "description": "An IfcLaborResource is used in construction with particular skills or crafts required to perform certain types of construction or management related work.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstructionmgmtdomain/lexical/ifclaborresource.htm" }, "IfcLampType": { "attributes": { "PredefinedType": "Identifies the predefined types of lamp from which the type required may be set." }, - "description": "Identifies the predefined types of lamp from which the type required may be set.", + "description": "An IfcLampType is a type of device that is designed to emit light.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifclamptype.htm" }, "IfcLibraryInformation": { @@ -2172,38 +2172,38 @@ "Version": "Identifier for the library version used for reference.", "VersionDate": "Date of the referenced version of the library." }, - "description": "Information on the library being referenced.", + "description": "An IfcLibraryInformation is a class that describes a library where a library is a structured store of information, normally organized in a manner which allows information lookup through an index or reference value. IfcLibraryInformation provides the library name and optional version, version date and publisher attributes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifclibraryinformation.htm" }, "IfcLibraryReference": { "attributes": { "ReferenceIntoLibrary": "The library information that is being referenced." }, - "description": "The library information that is being referenced.", + "description": "An IfcLibraryReference is a reference into a library of information by location (as an URL). It also provides an optional inherited ItemReference key to allow more specific references to library sections or tables, and the inherited Name attribute allows for a human interpretable identification of the library item. Also, general information on the external library can be given through IfcLibraryInformation, accessed by ReferenceIntoLibrary.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcexternalreferenceresource/lexical/ifclibraryreference.htm" }, "IfcLightDistributionData": { "attributes": { "LuminousIntensity": "The luminous intensity distribution measure for this pair of main and secondary plane angles according to the light distribution curve chosen.", "MainPlaneAngle": "The main plane angle (A, B or C angles, according to the light distribution curve chosen).", - "SecondaryPlaneAngle": "The list of secondary plane angles (the α, β or γ angles) according to the light distribution curve chosen. > NOTE: The _SecondaryPlaneAngle_ and _LuminousIntensity_ lists are corresponding lists." + "SecondaryPlaneAngle": "The list of secondary plane angles (the \u03b1, \u03b2 or \u03b3 angles) according to the light distribution curve chosen. > NOTE: The _SecondaryPlaneAngle_ and _LuminousIntensity_ lists are corresponding lists." }, - "description": "The luminous intensity distribution measure for this pair of main and secondary plane angles according to the light distribution curve chosen.", + "description": "The IfcLightDistributionData defines the luminous intensity of a light source given at a particular main plane angle. It is based on some standardized light distribution curves, the MainPlaneAngle is either the", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightdistributiondata.htm" }, "IfcLightFixtureType": { "attributes": { "PredefinedType": "Identifies the predefined types of light fixture from which the type required may be set." }, - "description": "Identifies the predefined types of light fixture from which the type required may be set.", + "description": "An IfcLightFixtureType is a container type that is designed for the purpose of housing one or more lamps and the devices that control, restrict or vary their emission.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifclightfixturetype.htm" }, "IfcLightIntensityDistribution": { "attributes": { - "DistributionData": "Light distribution data applied to the light source. It is defined by a list of main plane angles (B or C according to the light distribution curve chosen) that includes (for each B or C angle) a second list of secondary plane angles (the β or γ angles) and the according luminous intensity distribution measures.", + "DistributionData": "Light distribution data applied to the light source. It is defined by a list of main plane angles (B or C according to the light distribution curve chosen) that includes (for each B or C angle) a second list of secondary plane angles (the \u03b2 or \u03b3 angles) and the according luminous intensity distribution measures.", "LightDistributionCurve": "Standardized light distribution curve used to define the luminous intensity of the light in all directions." }, - "description": "Light distribution data applied to the light source. It is defined by a list of main plane angles (B or C according to the light distribution curve chosen) that includes (for each B or C angle) a second list of secondary plane angles (the β or γ angles) and the according luminous intensity distribution measures.", + "description": "The IfcLightIntensityDistribution defines the the luminous intensity of a light source that changes according to the direction of the ray. It is based on some standardized light distribution curves, which are defined by the LightDistributionCurve attribute.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightintensitydistribution.htm" }, "IfcLightSource": { @@ -2213,7 +2213,7 @@ "LightColour": "Definition from ISO/CD 10303-46:1992: Based on the current lighting model, the colour of the light to be used for shading. Definition from VRML97 - ISO/IEC 14772-1:1997: The color field specifies the spectral color properties of both the direct and ambient light emission as an RGB value.", "Name": "The name given to the light source in presentation." }, - "description": "Definition from VRML97 - ISO/IEC 14772-1:1997: The intensity field specifies the brightness of the direct emission from the ligth. Light intensity may range from 0.0 (no light emission) to 1.0 (full intensity).", + "description": "Definition from ISO/CD 10303-46:1992: The light source entity is determined by the reflectance specified in the surface style rendering. Lighting is applied on a surface by surface basis: no interactions between surfaces such as shadows or reflections are defined.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightsource.htm" }, "IfcLightSourceAmbient": { @@ -2224,7 +2224,7 @@ "attributes": { "Orientation": "Definition from ISO/CD 10303-46:1992: This direction is the direction of the light source. Definition from VRML97 - ISO/IEC 14772-1:1997: The direction field specifies the direction vector of the illumination emanating from the light source in the local coordinate system. Light is emitted along parallel rays from an infinite distance away." }, - "description": "Definition from ISO/CD 10303-46:1992: This direction is the direction of the light source. Definition from VRML97 - ISO/IEC 14772-1:1997: The direction field specifies the direction vector of the illumination emanating from the light source in the local coordinate system. Light is emitted along parallel rays from an infinite distance away.", + "description": "Definition from ISO/CD 10303-46:1992: The light source directional is a subtype of light source. This entity has a light source direction. With a conceptual origin at infinity, all the rays of the light are parallel to this direction. This kind of light source lights a surface based on the surface's orientation, but not position.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightsourcedirectional.htm" }, "IfcLightSourceGoniometric": { @@ -2236,7 +2236,7 @@ "LuminousFlux": "Luminous flux is a photometric measure of radiant flux, i.e. the volume of light emitted from a light source. Luminous flux is measured either for the interior as a whole or for a part of the interior (partial luminous flux for a solid angle). All other photometric parameters are derivatives of luminous flux. Luminous flux is measured in lumens (lm). The luminous flux is given as a nominal value for each lamp.", "Position": "The position of the light source. It is used to orientate the light distribution curves." }, - "description": "The data source from which light distribution data is obtained.", + "description": "The IfcLightSourceGoniometric defines a light source for which exact lighting data is available. It specifies the type of a light emitter, defines the position and orientation of a light distribution curve and the data concerning lamp and photometric information.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightsourcegoniometric.htm" }, "IfcLightSourcePositional": { @@ -2247,7 +2247,7 @@ "QuadricAttenuation": "Definition from the IAI: This real indicates the value of the attenuation in the lighting equation that proportional to the square value of the distance from the light source.", "Radius": "The maximum distance from the light source for a surface still to be illuminated. Definition from VRML97 - ISO/IEC 14772-1:1997: A Point light node illuminates geometry within radius of its location." }, - "description": "Definition from the IAI: This real indicates the value of the attenuation in the lighting equation that proportional to the square value of the distance from the light source.", + "description": "Definition from ISO/CD 10303-46:1992: The light source positional entity is a subtype of light source. This entity has a light source position and attenuation coefficients. A positional light source affects a surface based on the surface's orientation and position.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightsourcepositional.htm" }, "IfcLightSourceSpot": { @@ -2257,7 +2257,7 @@ "Orientation": "Definition from ISO/CD 10303-46:1992: This is the direction of the axis of the cone of the light source specified in the coordinate space of the representation being projected.. Definition from VRML97 - ISO/IEC 14772-1:1997: The direction field specifies the direction vector of the light's central axis defined in the local coordinate system.", "SpreadAngle": "Definition from ISO/CD 10303-46:1992: This planar angle measure is the angle between the line that starts at the position of the spot light source and is in the direction of the spot light source and any line on the boundary of the cone of influence. Definition from VRML97 - ISO/IEC 14772-1:1997: The cutOffAngle (name of spread angle in VRML) field specifies the outer bound of the solid angle. The light source does not emit light outside of this solid angle." }, - "description": "Definition from VRML97 - ISO/IEC 14772-1:1997: The beamWidth field specifies an inner solid angle in which the light source emits light at uniform full intensity. The light source's emission intensity drops off from the inner solid angle (beamWidthAngle) to the outer solid angle (spreadAngle).", + "description": "Definition from ISO/CD 10303-46:1992: The light source spot entity is a subtype of light source. Spot light source entities have a light source colour, position, direction, attenuation coefficients, concentration exponent, and spread angle. If a point lies outside the cone of influence of a light source of this type as determined by the light source position, direction and spread angle its colour is not affected by that light source.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifclightsourcespot.htm" }, "IfcLine": { @@ -2265,7 +2265,7 @@ "Dir": "The direction of the line, the magnitude and units of Dir affect the parameterization of the line.", "Pnt": "The location of the line." }, - "description": "The direction of the line, the magnitude and units of Dir affect the parameterization of the line.", + "description": "Definition from ISO/CD 10303-42:1992: A line is an unbounded curve with constant tangent direction. A line is defined by a point and a direction. The positive direction of the line is in the direction of the Dir vector. The line is parameterized as follows:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcline.htm" }, "IfcLinearDimension": { @@ -2277,7 +2277,7 @@ "PlacementRelTo": "Reference to Object that provides the relative placement by its local coordinate system. If it is omitted, then the local placement is given to the WCS, established by the geometric representation context.", "RelativePlacement": "Geometric placement that defines the transformation from the related coordinate system into the relating. The placement can be either 2D or 3D, depending on the dimension count of the coordinate system." }, - "description": "Geometric placement that defines the transformation from the related coordinate system into the relating. The placement can be either 2D or 3D, depending on the dimension count of the coordinate system.", + "description": "Definition from IFC: The IfcLocalPlacement defines the relative placement of a product in relation to the placement of another product or the absolute placement of a product within the geometric representation context of the project.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifclocalplacement.htm" }, "IfcLocalTime": { @@ -2288,7 +2288,7 @@ "SecondComponent": "The number of seconds of the local time.", "Zone": "The relationship of the local time to coordinated universal time." }, - "description": "The offset of daylight saving time from basis time.", + "description": "Definition from ISO/CD 10303-41:1992: A moment of occurrence measured by hour, minute, and second. It represents one instant of time on a 24 hour clock.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcdatetimeresource/lexical/ifclocaltime.htm" }, "IfcLoop": { @@ -2299,7 +2299,7 @@ "attributes": { "Outer": "A closed shell defining the exterior boundary of the solid. The shell normal shall point away from the interior of the solid." }, - "description": "A closed shell defining the exterior boundary of the solid. The shell normal shall point away from the interior of the solid.", + "description": "Definition from ISO/CD 10303-42:1992: A manifold solid B-rep is a finite, arcwise connected volume bounded by one or more surfaces, each of which is a connected, oriented, finite, closed 2-manifold. There is no restriction on the genus of the volume, nor on the number of voids within the volume.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcmanifoldsolidbrep.htm" }, "IfcMappedItem": { @@ -2307,16 +2307,16 @@ "MappingSource": "A representation map that is the source of the mapped item. It can be seen as a block (or cell or marco) definition.", "MappingTarget": "A representation item that is the target onto which the mapping source is mapped. It is constraint to be a Cartesian transformation operator." }, - "description": "A representation item that is the target onto which the mapping source is mapped. It is constraint to be a Cartesian transformation operator.", + "description": "Definition from ISO/CD 10303-43:1992: A mapped item is the use of an existing representation (the mapping source - mapped representation) as a representation item in a second representation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcmappeditem.htm" }, "IfcMaterial": { "attributes": { "ClassifiedAs": "Reference to the relationship pointing to the classification(s) of the material.", - "HasRepresentation": "Reference to the _IfcMaterialDefinitionRepresentation_ that provides presentation information to a representation common to this material in style definitions. > IFC2x Edition 3 CHANGE  The inverse attribute HasRepresentation has been added.", + "HasRepresentation": "Reference to the _IfcMaterialDefinitionRepresentation_ that provides presentation information to a representation common to this material in style definitions.", "Name": "Name of the material." }, - "description": "Reference to the relationship pointing to the classification(s) of the material.", + "description": "A homogeneous substance that can be used to form elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmaterial.htm" }, "IfcMaterialClassificationRelationship": { @@ -2324,14 +2324,14 @@ "ClassifiedMaterial": "Material being classified.", "MaterialClassifications": "The material classifications identifying the type of material." }, - "description": "Material being classified.", + "description": "Relationship assigning classifications to materials.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmaterialclassificationrelationship.htm" }, "IfcMaterialDefinitionRepresentation": { "attributes": { "RepresentedMaterial": "Reference to the material to which the representation applies." }, - "description": "Reference to the material to which the representation applies.", + "description": "The IfcMaterialDefinitionRepresentation defines presentation information relating to IfcMaterial. It allows for multiple presentations of the same material for different geometric representation contexts. ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcmaterialdefinitionrepresentation.htm" }, "IfcMaterialLayer": { @@ -2341,7 +2341,7 @@ "Material": "Optional reference to the material from which the layer is constructed. Note, that if this value is not given, it does not denote a layer with no material (an air gap), it only means that the material is not specified at that point.", "ToMaterialLayerSet": "Reference to the material layer set, in which the material layer is included." }, - "description": "Reference to the material layer set, in which the material layer is included.", + "description": "A single and identifiable part of an element which is constructed of a number of layers (one or more). Each IfcMaterialLayer is located relative to the referencing IfcMaterialLayerSet.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmateriallayer.htm" }, "IfcMaterialLayerSet": { @@ -2350,31 +2350,31 @@ "MaterialLayers": "Identification of the layers from which the material layer set is composed.", "TotalThickness": "Total thickness of the material layer set is derived from the function IfcMlsTotalThickness. IfcMlsTotalThickness(SELF)" }, - "description": "Total thickness of the material layer set is derived from the function IfcMlsTotalThickness. IfcMlsTotalThickness(SELF)", + "description": "Definition from IAI: A designation by which materials of an element constructed of a number of material layers is known and through which the relative positioning of individual layers can be expressed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmateriallayerset.htm" }, "IfcMaterialLayerSetUsage": { "attributes": { "DirectionSense": "Denotion whether the layer set is oriented in positive or negative sense relative to the material layer set base. The meaning of \"positive\" and \"negative\" needs to be established in the geometry use definitions. See examples at _IfcMaterialLayerSetUsage_ for a guideline as well.", "ForLayerSet": "The _IfcMaterialLayerSet_ set to which the usage is applied.", - "LayerSetDirection": "Orientation of the layer set relative to element reference geometry. The meaning of the value of this attribute shall be specified in the geometry use section for each element. For extruded shape representation, direction can be given along the extrusion path (e.g. for slabs) or perpendicular to it (e.g. for walls). > NOTE  the LayerSetDirection for IfcWallStandardCase shall be AXIS2 (i.e. the y-axis) and for standard IfcSlab it shall be AXIS3 (i.e. the z-axis). ", + "LayerSetDirection": "Orientation of the layer set relative to element reference geometry. The meaning of the value of this attribute shall be specified in the geometry use section for each element. For extruded shape representation, direction can be given along the extrusion path (e.g. for slabs) or perpendicular to it (e.g. for walls). > NOTE the LayerSetDirection for IfcWallStandardCase shall be AXIS2 (i.e. the y-axis) and for standard IfcSlab it shall be AXIS3 (i.e. the z-axis).", "OffsetFromReferenceLine": "Offset of the material layer set base line (MlsBase) from reference geometry (line or plane). The offset can be positive or negative, unless restricted for a particular building element type in its use definition or by implementer agreement. The reference geometry for each relevant subtype of _IfcElement_ is defined in use definition for the element. Examples are given in the use definition of _IfcMaterialLayerSetUsage_." }, - "description": "Offset of the material layer set base line (MlsBase) from reference geometry (line or plane). The offset can be positive or negative, unless restricted for a particular building element type in its use definition or by implementer agreement. The reference geometry for each relevant subtype of _IfcElement_ is defined in use definition for the element. Examples are given in the use definition of _IfcMaterialLayerSetUsage_.", + "description": "Definition from IAI: Determines the usage of IfcMaterialLayerSet in terms of its location and orientation relative to the associated element geometry. The location of material layer set shall be compatible with the building element geometry (i.e. material layers shall fit inside the element geometry). The rules to ensure the compatibility depend on the type of the building element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmateriallayersetusage.htm" }, "IfcMaterialList": { "attributes": { "Materials": "Materials used in a composition of substances." }, - "description": "Materials used in a composition of substances.", + "description": "A list of the different materials that are used in an element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialresource/lexical/ifcmateriallist.htm" }, "IfcMaterialProperties": { "attributes": { "Material": "Reference to the material to which the set of properties is assigned." }, - "description": "Reference to the material to which the set of properties is assigned.", + "description": "Abstract supertype of all container classes with material properties, both those defined in IFC specification and those defined by users as extended material properties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcmaterialproperties.htm" }, "IfcMeasureWithUnit": { @@ -2382,7 +2382,7 @@ "UnitComponent": "The unit in which the physical quantity is expressed.", "ValueComponent": "The value of the physical quantity when expressed in the specified units." }, - "description": "The unit in which the physical quantity is expressed.", + "description": "Definition from ISO/CD 10303-41:1992: A measure with unit is the specification of a physical quantity as defined in ISO 31 (clause 2).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcmeasurewithunit.htm" }, "IfcMechanicalConcreteMaterialProperties": { @@ -2394,7 +2394,7 @@ "WaterImpermeability": "Description of the water impermeability denoting the water repelling properties.", "Workability": "Description of the workability of the fresh concrete defined according to local standards." }, - "description": "Description of the water impermeability denoting the water repelling properties.", + "description": "", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcmechanicalconcretematerialproperties.htm" }, "IfcMechanicalFastener": { @@ -2402,7 +2402,7 @@ "NominalDiameter": "The nominal diameter describing the cross-section size of the fastener.", "NominalLength": "The nominal length describing the longitudinal dimensions of the fastener." }, - "description": "The nominal length describing the longitudinal dimensions of the fastener.", + "description": "Fasteners connecting building elements mechanically.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedcomponentelements/lexical/ifcmechanicalfastener.htm" }, "IfcMechanicalFastenerType": { @@ -2417,7 +2417,7 @@ "ThermalExpansionCoefficient": "A measure of the expansion coefficient for warming up the material about one Kelvin.", "YoungModulus": "A measure of the Young's modulus of elasticity of the material." }, - "description": "A measure of the expansion coefficient for warming up the material about one Kelvin.", + "description": "This is a collection of mechanical material properties normally used for structural analysis purpose. It contains all properties which are independent of the actual material type.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcmechanicalmaterialproperties.htm" }, "IfcMechanicalSteelMaterialProperties": { @@ -2430,7 +2430,7 @@ "UltimateStress": "A measure of the ultimate stress of the material.", "YieldStress": "A measure of the yield stress (or characteristic 0.2 percent proof stress) of the material." }, - "description": "Measures of decrease in stress over long time intervals resulting from plastic flow. Different relaxation values for different initial stress levels for a material may be given.", + "description": "This is a collection of mechanical properties related to steel (or other metallic and isotropic) materials.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcmechanicalsteelmaterialproperties.htm" }, "IfcMember": { @@ -2441,7 +2441,7 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a linear structural member element from which the type required may be set." }, - "description": "Identifies the predefined types of a linear structural member element from which the type required may be set.", + "description": "The element type (IfcMemberType) defines a list of commonly shared property set definitions of a structural member and an optional set of product representations. It is used to define a structural member specification (i.e. the specific product information that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcmembertype.htm" }, "IfcMetric": { @@ -2450,21 +2450,21 @@ "DataValue": "Value with data type defined by the DataType enumeration.", "ValueSource": "Reference source for data values." }, - "description": "Value with data type defined by the DataType enumeration.", + "description": "An IfcMetric is used to capture quantitative resultant metrics that can be applied to objectives.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcmetric.htm" }, "IfcMonetaryUnit": { "attributes": { "Currency": "The international enumeration name of the currency." }, - "description": "The international enumeration name of the currency.", + "description": "IfcMonetaryUnit is a unit to define currency for money.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcmonetaryunit.htm" }, "IfcMotorConnectionType": { "attributes": { "PredefinedType": "Identifies the predefined types of motor connection from which the type required may be set." }, - "description": "Identifies the predefined types of motor connection from which the type required may be set.", + "description": "An IfcMotorConnectionType provides the means for connecting a motor as the driving device to the driven device.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcmotorconnectiontype.htm" }, "IfcMove": { @@ -2473,7 +2473,7 @@ "MoveTo": "The place to which actors and their associated equipment are moving.", "PunchList": "A list of points concerning a move that require attention." }, - "description": "A list of points concerning a move that require attention.", + "description": "An IfcMove is an activity that moves people, groups within an organization or complete organizations together with their associated furniture and equipment from one place to another. The objects to be moved, normally people, equipment, and furniture, are assigned by the IfcRelAssignsToProcess relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcfacilitiesmgmtdomain/lexical/ifcmove.htm" }, "IfcNamedUnit": { @@ -2481,7 +2481,7 @@ "Dimensions": "The dimensional exponents of the SI base units by which the named unit is defined.", "UnitType": "The type of the unit." }, - "description": "The type of the unit.", + "description": "Definition from ISO/CD 10303-41:1992: A named unit is a unit quantity associated with the word, or group of words, by which the unit is identified.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcnamedunit.htm" }, "IfcObject": { @@ -2489,7 +2489,7 @@ "IsDefinedBy": "Set of relationships to type or property (statically or dynamically defined) information that further define the object. In case of type information, the associated _IfcTypeObject_ contains the specific information (or type, or style), that is common to all instances of _IfcObject_ referring to the same type.", "ObjectType": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute _PredefinedType_ is set to USERDEFINED." }, - "description": "Set of relationships to type or property (statically or dynamically defined) information that further define the object. In case of type information, the associated _IfcTypeObject_ contains the specific information (or type, or style), that is common to all instances of _IfcObject_ referring to the same type.", + "description": "An IfcObject is the generalization of any semantically treated thing or process. Objects are things as they appear - i.e. occurrences.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcobject.htm" }, "IfcObjectDefinition": { @@ -2499,15 +2499,15 @@ "HasAssociations": "Reference to the relationship objects, that associates external references or other resource definitions to the object.. Examples are the association to library, documentation or classification.", "IsDecomposedBy": "Reference to the decomposition relationship, that allows this object to be the composition of other objects. An object can be decomposed by several other objects." }, - "description": "Reference to the relationship objects, that associates external references or other resource definitions to the object.. Examples are the association to library, documentation or classification.", + "description": "Definition from IAI: An IfcObjectDefinition is the generalization of any semantically treated thing or process, either being a type or an occurrences. Object defintions can be named, using the inherited Name attribute, which should be a user recognizable label for the object occurrence. Further explanations to the object can be given using the inherited Description attribute. ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcobjectdefinition.htm" }, "IfcObjectPlacement": { "attributes": { - "PlacesObject": "The _IfcObjectPlacement_ shall be used to provide a placement and an object coordinate system for a single instance of _IfcProduct_. > IFC2x Edition 3 CHANGE  New inverse attribute. ", + "PlacesObject": "The _IfcObjectPlacement_ shall be used to provide a placement and an object coordinate system for a single instance of _IfcProduct_.", "ReferencedByPlacements": "Placements that are given relative to this placement of an object." }, - "description": "Placements that are given relative to this placement of an object.", + "description": "Abstract supertype for the special types defining the object coordinate system. The IfcObjectPlacement has to be provided for each product that has a shape representation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcobjectplacement.htm" }, "IfcObjective": { @@ -2517,14 +2517,14 @@ "ResultValues": "A list of any resultant values used for comparison purposes.", "UserDefinedQualifier": "A user defined value that qualifies the type of objective constraint when ObjectiveQualifier attribute of type _IfcObjectiveEnum_ has value USERDEFINED." }, - "description": "A user defined value that qualifies the type of objective constraint when ObjectiveQualifier attribute of type _IfcObjectiveEnum_ has value USERDEFINED.", + "description": "An IfcObjective captures qualitative information for an objective-based constraint.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcobjective.htm" }, "IfcOccupant": { "attributes": { "PredefinedType": "Predefined occupant types from which that required may be set." }, - "description": "Predefined occupant types from which that required may be set.", + "description": "An_IfcOccupant_ is a type of actor that defines the form of occupancy of a property.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcoccupant.htm" }, "IfcOffsetCurve2D": { @@ -2533,7 +2533,7 @@ "Distance": "The distance of the offset curve from the basis curve. distance may be positive, negative or zero. A positive value of distance defines an offset in the direction which is normal to the curve in the sense of an anti-clockwise rotation through 90 degrees from the tangent vector T at the given point. (This is in the direction of orthogonal complement(T).)", "SelfIntersect": "An indication of whether the offset curve self-intersects; this is for information only." }, - "description": "An indication of whether the offset curve self-intersects; this is for information only.", + "description": "Definition from ISO/CD 10303-42:1992: An offset curve 2d (IfcOffsetCurve2d) is a curve at a constant distance from a basis curve in two-dimensional space. This entity defines a simple plane-offset curve by offsetting by distance along the normal to basis curve in the plane of basis curve. The underlying curve shall have a well-defined tangent direction at every point. In the case of a composite curve, the transition code between each segment shall be cont same gradient or cont same gradient same curvature.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcoffsetcurve2d.htm" }, "IfcOffsetCurve3D": { @@ -2543,14 +2543,14 @@ "RefDirection": "The direction used to define the direction of the offset curve 3d from the basis curve.", "SelfIntersect": "An indication of whether the offset curve self-intersects, this is for information only." }, - "description": "The direction used to define the direction of the offset curve 3d from the basis curve.", + "description": "Definition from ISO/CD 10303-42:1992: An offset curve 3d is a curve at a constant distance from a basis curve in three-dimensional space. The underlying curve shall have a well-defined tangent direction at every point. In the case of a composite curve the transition code between each segment shall be cont same gradient or cont same gradient same curvature. The offset curve at any point (parameter) on the basis curve is in the direction V x T where V is the fixed reference direction and T is the unit tangent to the basis curve. For the offset direction to be well defined, T shall not at any point of the curve be in the same, or opposite, direction as V.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcoffsetcurve3d.htm" }, "IfcOneDirectionRepeatFactor": { "attributes": { "RepeatFactor": "A vector which specifies the relative positioning of hatch lines." }, - "description": "A vector which specifies the relative positioning of hatch lines.", + "description": "Definition from ISO/CD 10303-46:1992: A one time repeat factor is a vector used in the fill area style hatching and fill area style tiles entities for determining the origin of the repeated hatch line relative to the origin of the previous hatch line, Given the initial position of any hatch line, the one direction repeat factor determines two new positions according to the equation:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifconedirectionrepeatfactor.htm" }, "IfcOpenShell": { @@ -2561,7 +2561,7 @@ "attributes": { "HasFillings": "Reference to the Filling Relationship that is used to assign Elements as Fillings for this Opening Element. The Opening Element can be filled with zero-to-many Elements." }, - "description": "Reference to the Filling Relationship that is used to assign Elements as Fillings for this Opening Element. The Opening Element can be filled with zero-to-many Elements.", + "description": "The opening element stands for opening, recess or chase, all reflecting voids. It represents a void within any element that has physical manifestation. Openings must be handled by all sectors and disciplines in AEC/FM industry, therefore the interoperability for opening elements is provided at this high level.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcopeningelement.htm" }, "IfcOpticalMaterialProperties": { @@ -2576,19 +2576,19 @@ "VisibleReflectanceFront": "Reflectance at normal incidence (visible): front side. Defines the fraction of the solar ray in the visible spectrum that is reflected and not transmitted when the ray passes from one medium into another, at the \"front\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics.", "VisibleTransmittance": "Transmittance at normal incidence (visible). Defines the fraction of the visible spectrum of solar radiation that passes through per unit area, perpendicular to the surface." }, - "description": "Reflectance at normal incidence (solar): back side. Defines the fraction of the solar ray that is reflected and not transmitted when the ray passes from one medium into another, at the \"back\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics.", + "description": "A container class with material optical properties defined in IFC specification.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcopticalmaterialproperties.htm" }, "IfcOrderAction": { "attributes": { "ActionID": "A unique identifier assigned to an action on issue." }, - "description": "A unique identifier assigned to an action on issue.", + "description": "An IfcOrderAction is the point at which requests for work are received and processed within an organization.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcfacilitiesmgmtdomain/lexical/ifcorderaction.htm" }, "IfcOrganization": { "attributes": { - "Addresses": "Postal and telecom addresses of an organization. > NOTE: There may be several addresses related to an organization. ", + "Addresses": "Postal and telecom addresses of an organization. > NOTE: There may be several addresses related to an organization.", "Description": "Text that relates the nature of the organization.", "Engages": "Inverse relationship to IfcPersonAndOrganization relationships in which IfcOrganization is engaged.", "Id": "Identification of the organization.", @@ -2597,7 +2597,7 @@ "Relates": "The inverse relationship for relationship RelatingOrganization of IfcOrganizationRelationship.", "Roles": "Roles played by the organization." }, - "description": "Inverse relationship to IfcPersonAndOrganization relationships in which IfcOrganization is engaged.", + "description": "A named and structured grouping with a corporate identity.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcorganization.htm" }, "IfcOrganizationRelationship": { @@ -2607,7 +2607,7 @@ "RelatedOrganizations": "The other, possibly dependent, organizations which are the related parts of the relationship between organizations.", "RelatingOrganization": "Organization which is the relating part of the relationship between organizations." }, - "description": "The other, possibly dependent, organizations which are the related parts of the relationship between organizations.", + "description": "IfcOrganizationRelationship establishes an association between one relating organization, and one or more related organizations.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcorganizationrelationship.htm" }, "IfcOrientedEdge": { @@ -2617,14 +2617,14 @@ "EdgeStart": "The start vertex of the oriented edge. It derives from the vertices of the edge element after taking account of the orientation. IfcBooleanChoose (Orientation, EdgeElement.EdgeStart, EdgeElement.EdgeEnd)", "Orientation": "BOOLEAN, If TRUE the topological orientation as used coincides with the orientation from start vertex to end vertex of the edge element. If FALSE otherwise." }, - "description": "The end vertex of the oriented edge. It derives from the vertices of the edge element after taking account of the orientation. IfcBooleanChoose (Orientation, EdgeElement.EdgeEnd, EdgeElement.EdgeStart)", + "description": "Definition from ISO/CD 10303-42:1992: An oriented edge is an edge constructed from another edge and contains a BOOLEAN direction flag to indicate whether or not the orientation of the constructed edge agrees with the orientation of the original edge. Except for perhaps orientation, the oriented edge is equivalent to the original edge.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcorientededge.htm" }, "IfcOutletType": { "attributes": { "PredefinedType": "Identifies the predefined types of outlet from which the type required may be set." }, - "description": "Identifies the predefined types of outlet from which the type required may be set.", + "description": "An IfcOutletType defines a particular type of outlet which is a device installed at a point to receive an inserted plug.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcoutlettype.htm" }, "IfcOwnerHistory": { @@ -2638,28 +2638,28 @@ "OwningUser": "Direct reference to the end user who currently \"owns\" this object. Note that IFC includes the concept of ownership transfer from one user to another and therefore distinguishes between the Owning User and Creating User.", "State": "Enumeration that defines the current access state of the object." }, - "description": "Time and date of creation.", + "description": "IfcOwnerHistory defines all history and identification related information. In order to provide fast access it is directly attached to all independent objects, relationships and properties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcutilityresource/lexical/ifcownerhistory.htm" }, "IfcParameterizedProfileDef": { "attributes": { "Position": "Position coordinate system of the parameterized profile definition." }, - "description": "Position coordinate system of the parameterized profile definition.", + "description": "The parameterized profile definition defines a 2D position coordinate system to which the parameters of the different profiles relate to. All profiles are defined centric to the origin of the position coordinate system, or more specific, the origin [0.,0.] shall be in the center of the bounding box ~~gravity~~ of the profile.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcparameterizedprofiledef.htm" }, "IfcPath": { "attributes": { "EdgeList": "The list of oriented edges which are concatenated together to form this path." }, - "description": "The list of oriented edges which are concatenated together to form this path.", + "description": "Definition from ISO/CD 10303-42:1992: A path is a topological entity consisting of an ordered collection of oriented edges, such that the edge start vertex of each edge coincides with the edge end of its predecessor. The path is ordered from the edge start of the first oriented edge to the edge end of the last edge. The BOOLEAN value sense in the oriented edge indicates whether the edge direction agrees with the direction of the path (TRUE) or is the opposite direction (FALSE).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcpath.htm" }, "IfcPerformanceHistory": { "attributes": { "LifeCyclePhase": "Describes the applicable building life-cycle phase. Typical values should be DESIGNDEVELOPMENT, SCHEMATICDEVELOPMENT, CONSTRUCTIONDOCUMENT, CONSTRUCTION, ASBUILT, COMMISSIONING, OPERATION, etc." }, - "description": "Describes the applicable building life-cycle phase. Typical values should be DESIGNDEVELOPMENT, SCHEMATICDEVELOPMENT, CONSTRUCTIONDOCUMENT, CONSTRUCTION, ASBUILT, COMMISSIONING, OPERATION, etc.", + "description": "The IfcPerformanceHistory is used to document the actual performance of an occurrence instance over time. In practice, performance-related data are generally not easy to obtain as they can originate from different sources (e.g. predicted, simulated, or measured) and occur during different stages of the building life-cycle. Such time-related data cover a large spectrum, including meteorological data, schedules, operational status measurements, trend reports, etc.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccontrolextension/lexical/ifcperformancehistory.htm" }, "IfcPermeableCoveringProperties": { @@ -2670,29 +2670,29 @@ "PanelPosition": "Position of this permeable covering panel within the overall window or door type.", "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the permeable covering." }, - "description": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the permeable covering.", + "description": "Definition from BS 6100: A permeable covering is a permeable cover for an opening which allows airflow .", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcarchitecturedomain/lexical/ifcpermeablecoveringproperties.htm" }, "IfcPermit": { "attributes": { "PermitID": "A unique identifier assigned to a permit." }, - "description": "A unique identifier assigned to a permit.", + "description": "An IfcPermit is a document that allows permission to carry out actions in places and on artifacts where security or other access restrictions apply.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcfacilitiesmgmtdomain/lexical/ifcpermit.htm" }, "IfcPerson": { "attributes": { - "Addresses": "Postal and telecommunication addresses of a person. > NOTE - A person may have several addresses. ", + "Addresses": "Postal and telecommunication addresses of a person. > NOTE - A person may have several addresses.", "EngagedIn": "The inverse relationship to IfcPersonAndOrganization relationships in which IfcPerson is engaged.", - "FamilyName": "The name by which the family identity of the person may be recognized. > NOTE: Depending on geographical location and culture, family name may appear either as the first or last component of a name.", - "GivenName": "The name by which a person is known within a family and by which he or she may be familiarly recognized. > NOTE: Depending on geographical location and culture, given name may appear either as the first or last component of a name. ", + "FamilyName": "The name by which the family identity of the person may be recognized. > NOTE: Depending on geographical location and culture, family name may appear either as the first or last component of a name.", + "GivenName": "The name by which a person is known within a family and by which he or she may be familiarly recognized. > NOTE: Depending on geographical location and culture, given name may appear either as the first or last component of a name.", "Id": "Identification of the person.", - "MiddleNames": "Additional names given to a person that enable their identification apart from others who may have the same or similar family and given names. > NOTE: Middle names are not normally used in familiar communication but may be asserted to provide additional identification of a particular person if necessary. They may be particularly useful in situations where the person concerned has a family name that occurs commonly in the geographical region. ", + "MiddleNames": "Additional names given to a person that enable their identification apart from others who may have the same or similar family and given names. > NOTE: Middle names are not normally used in familiar communication but may be asserted to provide additional identification of a particular person if necessary. They may be particularly useful in situations where the person concerned has a family name that occurs commonly in the geographical region.", "PrefixTitles": "The word, or group of words, which specify the person's social and/or professional standing and appear before his/her names.", "Roles": "Roles played by the person.", "SuffixTitles": "The word, or group of words, which specify the person's social and/or professional standing and appear after his/her names." }, - "description": "The inverse relationship to IfcPersonAndOrganization relationships in which IfcPerson is engaged.", + "description": "Definition from ISO/CD 10303-41:1992: An individual human being.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcperson.htm" }, "IfcPersonAndOrganization": { @@ -2701,7 +2701,7 @@ "TheOrganization": "The organization to which the person is related.", "ThePerson": "The person who is related to the organization." }, - "description": "Roles played by the person within the context of an organization.", + "description": "Identification of a person within an organization.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcpersonandorganization.htm" }, "IfcPhysicalComplexQuantity": { @@ -2711,7 +2711,7 @@ "Quality": "Additional indication of a quality of the quantities that are grouped under this physical complex quantity.", "Usage": "Additional indication of a usage type of the quantities that are grouped under this physical complex quantity." }, - "description": "Additional indication of a usage type of the quantities that are grouped under this physical complex quantity.", + "description": "The complex physical quantity, IfcPhysicalComplexQuantity, is an entity that holds a set of single quantity measure value (as defined at the subtypes of IfcPhysicalSimpleQuantity), that all apply to a given component or aspect of the element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcphysicalcomplexquantity.htm" }, "IfcPhysicalQuantity": { @@ -2720,14 +2720,14 @@ "Name": "Name of the element quantity or measure. The name attribute has to be made recognizable by further agreements.", "PartOfComplex": "Reference to a physical complex quantity in which the physical quantity may be contained." }, - "description": "Reference to a physical complex quantity in which the physical quantity may be contained.", + "description": "The physical quantity, IfcPhysicalQuantity, is an abstract entity that holds a complex or simple quantity measure together with a semantic definition of the usage for the single or several measure value.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcphysicalquantity.htm" }, "IfcPhysicalSimpleQuantity": { "attributes": { "Unit": "Optional assignment of a unit. If no unit is given, then the global unit assignment, as established at the IfcProject, applies to the quantity measures." }, - "description": "Optional assignment of a unit. If no unit is given, then the global unit assignment, as established at the IfcProject, applies to the quantity measures.", + "description": "The physical quantity, IfcPhysicalSimpleQuantity, is an entity that holds a single quantity measure value (as defined at the subtypes of IfcPhysicalSimpleQuantity) together with a semantic definition of the usage for the measure value.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcphysicalsimplequantity.htm" }, "IfcPile": { @@ -2735,31 +2735,31 @@ "ConstructionType": "General designator for how the pile is constructed.", "PredefinedType": "The predefined generic type of the pile according to function." }, - "description": "General designator for how the pile is constructed.", + "description": "A slender timber, concrete, or steel structural element, driven, jetted, or otherwise embedded on end in the ground for the purpose of supporting a load.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcpile.htm" }, "IfcPipeFittingType": { "attributes": { "PredefinedType": "The type of pipe fitting." }, - "description": "The type of pipe fitting.", + "description": "The element type IfcPipeFittingType defines a list of commonly shared property set definitions of a pipe fitting and an optional set of product representations. It is used to define a pipe fitting specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcpipefittingtype.htm" }, "IfcPipeSegmentType": { "attributes": { "PredefinedType": "The type of pipe segment." }, - "description": "The type of pipe segment.", + "description": "The element type IfcPipeSegmentType defines a list of commonly shared property set definitions of a pipe segment and an optional set of product representations. It is used to define a pipe segment specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcpipesegmenttype.htm" }, "IfcPixelTexture": { "attributes": { "ColourComponents": "Indication whether the pixel values contain a 1, 2, 3, or 4 colour component.", "Height": "The number of pixels in height (T) direction.", - "Pixel": "Flat list of hexadecimal values, each describing one pixel by 1, 2, 3, or 4 components. > IFC2x Edition 3 CHANGE  The data type has been changed from STRING to BINARY. ", + "Pixel": "Flat list of hexadecimal values, each describing one pixel by 1, 2, 3, or 4 components.", "Width": "The number of pixels in width (S) direction." }, - "description": "Flat list of hexadecimal values, each describing one pixel by 1, 2, 3, or 4 components. > IFC2x Edition 3 CHANGE  The data type has been changed from STRING to BINARY. ", + "description": "Definition from IAI: An IfcPixelTexture provides a 2D image-based texture map as an explicit array of pixel values (image field). In contrary to the IfcImageTexture the IfcPixelTexture holds a 2 dimensional list of pixel color (and opacity) directly, instead of referencing to an URL.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcpixeltexture.htm" }, "IfcPlacement": { @@ -2767,14 +2767,14 @@ "Dim": "The space dimensionality of this class, derived from the dimensionality of the location. Location.Dim", "Location": "The geometric position of a reference point, such as the center of a circle, of the item to be located." }, - "description": "The space dimensionality of this class, derived from the dimensionality of the location. Location.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A placement entity defines the local environment for the definition of a geometry item. It locates the item to be defined and, in the case of the axis placement subtypes, gives its orientation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcplacement.htm" }, "IfcPlanarBox": { "attributes": { - "Placement": "The _IfcAxis2Placement_ positions a local coordinate system for the definition of the rectangle. The origin of this local coordinate system serves as the lower left corner of the rectangular box. > NOTE  In case of a 3D placement by IfcAxisPlacement3D the IfcPlanarBox is defined within the xy plane of the definition coordinate system." + "Placement": "The _IfcAxis2Placement_ positions a local coordinate system for the definition of the rectangle. The origin of this local coordinate system serves as the lower left corner of the rectangular box. > NOTE In case of a 3D placement by IfcAxisPlacement3D the IfcPlanarBox is defined within the xy plane of the definition coordinate system." }, - "description": "The _IfcAxis2Placement_ positions a local coordinate system for the definition of the rectangle. The origin of this local coordinate system serves as the lower left corner of the rectangular box. > NOTE  In case of a 3D placement by IfcAxisPlacement3D the IfcPlanarBox is defined within the xy plane of the definition coordinate system.", + "description": "Definition from ISO/CD 10303-46:1992: A planar box specifies an arbitrary rectangular box and its location in a two dimensional Cartesian coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifcplanarbox.htm" }, "IfcPlanarExtent": { @@ -2782,7 +2782,7 @@ "SizeInX": "The extent in the direction of the x-axis.", "SizeInY": "The extent in the direction of the y-axis." }, - "description": "The extent in the direction of the y-axis.", + "description": "The planar extent defines the extent along the two axes of the two-dimensional coordinate system, independently of its position.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifcplanarextent.htm" }, "IfcPlane": { @@ -2797,7 +2797,7 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a planar structural member element from which the type required may be set." }, - "description": "Identifies the predefined types of a planar structural member element from which the type required may be set.", + "description": "The element type IfcPlateType defines a list of commonly shared property set definitions of a thin planar element and an optional set of product representations (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcplatetype.htm" }, "IfcPoint": { @@ -2810,7 +2810,7 @@ "Dim": "The space dimensionality of this class, determined by the space dimensionality of the basis curve. BasisCurve.Dim", "PointParameter": "The parameter value of the point location." }, - "description": "The space dimensionality of this class, determined by the space dimensionality of the basis curve. BasisCurve.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A point on curve is a point which lies on a curve. The point is determined by evaluating the curve at a specific parameter value. The coordinate space dimensionality of the point is that of the basis curve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcpointoncurve.htm" }, "IfcPointOnSurface": { @@ -2820,29 +2820,29 @@ "PointParameterU": "The first parameter value of the point location.", "PointParameterV": "The second parameter value of the point location." }, - "description": "The space dimensionality of this class, determined by the space dimensionality of the basis surface. BasisSurface.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A point on surface is a point which lies on a parametric surface. The point is determined by evaluating the surface at a particular pair of parameter values.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcpointonsurface.htm" }, "IfcPolyLoop": { "attributes": { "Polygon": "List of points defining the loop. There are no repeated points in the list." }, - "description": "List of points defining the loop. There are no repeated points in the list.", + "description": "Definition from ISO/CD 10303-42:1992: A poly loop is a loop with straight edges bounding a planar region in space. A poly loop is a loop of genus 1 where the loop is represented by an ordered coplanar collection of points forming the vertices of the loop. The loop is composed of straight line segments joining a point in the collection to the succeeding point in the collection. The closing segment is from the last to the first point in the collection. ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcpolyloop.htm" }, "IfcPolygonalBoundedHalfSpace": { "attributes": { - "PolygonalBoundary": "Two-dimensional ~~polyline~~ bounded curve, defined in the xy plane of the position coordinate system. > IFC2x Edition 3 CHANGE  The attribute type has been changed from IfcPolyline to its supertype IfcBoundedCurve with upward compatibility for file based exchange. ", + "PolygonalBoundary": "Two-dimensional ~~polyline~~ bounded curve, defined in the xy plane of the position coordinate system.", "Position": "Definition of the position coordinate system for the bounding polyline ~~and the base surface~~." }, - "description": "Two-dimensional ~~polyline~~ bounded curve, defined in the xy plane of the position coordinate system. > IFC2x Edition 3 CHANGE  The attribute type has been changed from IfcPolyline to its supertype IfcBoundedCurve with upward compatibility for file based exchange. ", + "description": "The polygonal bounded half space is a special subtype of a half space solid, where the material of the half space used in Boolean expressions is bounded by a polygonal boundary. The base surface of the half space is positioned by its normal relativeto the object coordinate system (as defined at the supertype IfcHalfSpaceSolid), and its polygonal (with or without arc segments) boundary is defined in the XY plane of the position coordinate system established by the Position attribute, the subtraction body is extruded perpendicular to the XY plane of the position coordinate system, i.e. into the direction of the positive Z axis defined by the Position attribute.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcpolygonalboundedhalfspace.htm" }, "IfcPolyline": { "attributes": { "Points": "The points defining the polyline." }, - "description": "The points defining the polyline.", + "description": "Definition from ISO/CD 10303-42:1992: An IfcPolyline is a bounded curve of n -1 linear segments, defined by a list of n points, P1, P2 ... Pn. The curve is parameterized as follows:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcpolyline.htm" }, "IfcPort": { @@ -2851,20 +2851,20 @@ "ConnectedTo": "Reference to the port connection relationship. The relationship then refers to the other port to which this port is connected.", "ContainedIn": "Reference to the element to port connection relationship. The relationship then refers to the element in which this port is contained." }, - "description": "Reference to the port connection relationship. The relationship then refers to the other port to which this port is connected.", + "description": "An IfcPort provides the means for an element to connect to other elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcport.htm" }, "IfcPostalAddress": { "attributes": { - "AddressLines": "The postal address. > NOTE: A postal address may occupy several lines (or elements) when recorded. It is expected that normal usage will incorporate relevant elements of the following address concepts: A location within a building (e.g. 3rd Floor) Building name (e.g. Interoperability House) Street number (e.g. 6400) Street name (e.g. Alliance Boulevard). Typical content of address lines may vary in different countries. ", + "AddressLines": "The postal address. > NOTE: A postal address may occupy several lines (or elements) when recorded. It is expected that normal usage will incorporate relevant elements of the following address concepts: A location within a building (e.g. 3rd Floor) Building name (e.g. Interoperability House) Street number (e.g. 6400) Street name (e.g. Alliance Boulevard). Typical content of address lines may vary in different countries.", "Country": "The name of a country.", "InternalLocation": "An organization defined address for internal mail delivery.", "PostalBox": "An address that is implied by an identifiable mail drop.", "PostalCode": "The code that is used by the country's postal service.", - "Region": "The name of a region. > NOTE: The counties of the United Kingdom and the states of North America are examples of regions. ", + "Region": "The name of a region. > NOTE: The counties of the United Kingdom and the states of North America are examples of regions.", "Town": "The name of a town." }, - "description": "The name of a country.", + "description": "The address for delivery of paper based mail.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifcpostaladdress.htm" }, "IfcPreDefinedColour": { @@ -2883,7 +2883,7 @@ "attributes": { "Name": "The string by which the pre defined item is identified. Allowable values for the string are declared at the level of subtypes." }, - "description": "The string by which the pre defined item is identified. Allowable values for the string are declared at the level of subtypes.", + "description": "A pre defined item is a qualified name given to a style, font, etc., which is determined within the data exchange specification by convention on using the Name attribute value (in contrary to externally defined items, which are agreed by an external source).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifcpredefineditem.htm" }, "IfcPreDefinedPointMarkerSymbol": { @@ -2909,7 +2909,7 @@ "Identifier": "An (internal) identifier assigned to the layer.", "Name": "Name of the layer." }, - "description": "An (internal) identifier assigned to the layer.", + "description": "Definition from ISO/CD 10303-46:1992: The presentation layer assignment entity assigns an identifying name and optionally a description to a set of presentation and representation items.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifcpresentationlayerassignment.htm" }, "IfcPresentationLayerWithStyle": { @@ -2917,23 +2917,23 @@ "LayerBlocked": "A logical setting, TRUE indicates that the layer is set to 'Blocked', FALSE that the layer is set to 'Not blocked', UNKNOWN that such information is not available.", "LayerFrozen": "A logical setting, TRUE indicates that the layer is set to 'Frozen', FALSE that the layer is set to 'Not frozen', UNKNOWN that such information is not available.", "LayerOn": "A logical setting, TRUE indicates that the layer is set to 'On', FALSE that the layer is set to 'Off', UNKNOWN that such information is not available.", - "LayerStyles": "Assignment of presentation styles to the layer to provide a default style for representation items. > NOTE  In most cases the assignment of styles to a layer is restricted to an IfcCurveStyle representing the layer curve colour, layer curve thickness, and layer curve type. " + "LayerStyles": "Assignment of presentation styles to the layer to provide a default style for representation items. > NOTE In most cases the assignment of styles to a layer is restricted to an IfcCurveStyle representing the layer curve colour, layer curve thickness, and layer curve type." }, - "description": "Assignment of presentation styles to the layer to provide a default style for representation items. > NOTE  In most cases the assignment of styles to a layer is restricted to an IfcCurveStyle representing the layer curve colour, layer curve thickness, and layer curve type. ", + "description": "An IfcPresentationLayerAssignmentWithStyle extends the presentation layer assignment with capabilities to define visibility control, access control and common style information.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationorganizationresource/lexical/ifcpresentationlayerwithstyle.htm" }, "IfcPresentationStyle": { "attributes": { "Name": "Name of the presentation style." }, - "description": "Name of the presentation style.", + "description": "Definition from IAI: An abstract generalization of style table for presentation information assigned to geometric representation items. It includes styles for curves, areas, surfaces, text and symbols. Style information may include colour, hatching, rendering, text fonts, etc.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcpresentationstyle.htm" }, "IfcPresentationStyleAssignment": { "attributes": { "Styles": "A set of presentation styles that are assigned to styled items." }, - "description": "A set of presentation styles that are assigned to styled items.", + "description": "Definition from ISO/CD 10303-46:1992: The presentation style assignment is a set of styles which are assigned to styled items for the purpose of presenting these styled items.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcpresentationstyleassignment.htm" }, "IfcProcedure": { @@ -2942,7 +2942,7 @@ "ProcedureType": "Predefined procedure types from which that required may be set.", "UserDefinedProcedureType": "A user defined procedure type." }, - "description": "A user defined procedure type.", + "description": "An IfcProcedure is an identifiable step to be taken within a process that is considered to occur over zero or a non-measurable period of time.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprocessextension/lexical/ifcprocedure.htm" }, "IfcProcess": { @@ -2951,7 +2951,7 @@ "IsSuccessorFrom": "Relative placement in time, refers to the previous processes for which this process is successor.", "OperatesOn": "Set of Relationships to objects that are operated on by the process." }, - "description": "Relative placement in time, refers to the subsequent processes for which this process is predecessor.", + "description": "An action taking place in building construction with the intent of designing, costing, acquiring, constructing, or maintaining products or other and similar tasks or procedures. Processes are placed in sequence (including overlapping for parallel tasks) in time, the relationship IfcRelSequence it used to capture the predecessors and successors of the process. Processes can have resources assigned to it, this is handled by the relationship IfcRelAssignsToProcess.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcprocess.htm" }, "IfcProduct": { @@ -2960,15 +2960,15 @@ "ReferencedBy": "Reference to the IfcRelAssignsToProduct relationship, by which other subtypes of IfcObject can be related to the product.", "Representation": "Reference to the representations of the product, being either a representation (IfcProductRepresentation) or as a special case a shape representations (IfcProductDefinitionShape). The product definition shape provides for multiple geometric representations of the shape property of the object within the same object coordinate system, defined by the object placement." }, - "description": "Reference to the IfcRelAssignsToProduct relationship, by which other subtypes of IfcObject can be related to the product.", + "description": "Any object, or any aid to define, organize and annotate an object, that relates to a geometric or spatial context. Subtypes of IfcProduct usually hold a shape representation and a local placement within the project structure.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcproduct.htm" }, "IfcProductDefinitionShape": { "attributes": { "HasShapeAspects": "Reference to the shape aspect that represents part of the shape or its feature distinctively.", - "ShapeOfProduct": "The _IfcProductDefinitionShape_ shall be used to provide a representation for a single instance of _IfcProduct_. > IFC2x Edition 3 CHANGE  New inverse attribute. " + "ShapeOfProduct": "The _IfcProductDefinitionShape_ shall be used to provide a representation for a single instance of _IfcProduct_." }, - "description": "Reference to the shape aspect that represents part of the shape or its feature distinctively.", + "description": "Definition from ISO/CD 10303-42:1992: A product definition shape identifies a product\u2019s shape as the conceptual idea of the form of a product.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcproductdefinitionshape.htm" }, "IfcProductRepresentation": { @@ -2977,7 +2977,7 @@ "Name": "The word or group of words by which the product representation is known.", "Representations": "Contained list of representations (including shape representations). Each member defines a valid representation of a particular type within a particular representation context." }, - "description": "Contained list of representations (including shape representations). Each member defines a valid representation of a particular type within a particular representation context.", + "description": "The IfcProductRepresentation defines a representation of a product, including its (geometric or topological) representation. A product can have zero, one or many geometric representations, and a single geometric representation can be shared among various products using mapped representations.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcproductrepresentation.htm" }, "IfcProductsOfCombustionProperties": { @@ -2987,7 +2987,7 @@ "N20Content": "Nitrous Oxide (N~2~O) content of the products of combustion. This is measured in weight of N~2~O per unit weight and is therefore unitless.", "SpecificHeatCapacity": "Specific heat of the products of combustion: heat energy absorbed per temperature unit. Usually measured in [J/kg K]." }, - "description": "Carbon Dioxide (CO~2~) content of the products of combustion. This is measured in weight of CO~2~ per unit weight and is therefore unitless.", + "description": "Common definition to capture the properties of products of combustion generated by elements typically used within the context of building services and flow distribution systems.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcproductsofcombustionproperties.htm" }, "IfcProfileDef": { @@ -2995,7 +2995,7 @@ "ProfileName": "Name of the profile type according to some standard profile table.", "ProfileType": "Defines the type of geometry into which this profile definition shall be resolved, either a curve or a surface area. In case of curve the profile should be referenced by a swept surface, in case of area the profile should be referenced by a swept area solid." }, - "description": "Name of the profile type according to some standard profile table.", + "description": "Definition from IAI: The IfcProfileDef is the supertype of all definitions of standard and arbitrary profiles within IFC. It is used to define a standard set of commonly used profiles by their parameters or by their explicit curve geometry. Those profile definitions are used within the geometry and geometric model resource to create either swept surfaces, swept area solids, or sectioned spines.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcprofiledef.htm" }, "IfcProfileProperties": { @@ -3003,7 +3003,7 @@ "ProfileDefinition": "Optional reference to an instance of IfcProfileDef, which contains a further geometrical definition.", "ProfileName": "Standardized profile name as published in a profile table. All profile properties are applicable to this standardized profile name." }, - "description": "Optional reference to an instance of IfcProfileDef, which contains a further geometrical definition.", + "description": "This is a collection of properties applicable to all linear structural members having a profile definition.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcprofileproperties.htm" }, "IfcProject": { @@ -3013,7 +3013,7 @@ "RepresentationContexts": "Context of the representations used within the project. When the project includes shape representations for its components, one or several geometric representation contexts need to be included that define e.g. the world coordinate system, the coordinate space dimensions, and/or the precision factor.", "UnitsInContext": "Units globally assigned to measure types used within the context of this project." }, - "description": "Units globally assigned to measure types used within the context of this project.", + "description": "The undertaking of some design, engineering, construction, or maintenance activities leading towards a product. The project establishes the context for information to be exchanged or shared, and it may represent a construction project but does not have to.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcproject.htm" }, "IfcProjectOrder": { @@ -3022,7 +3022,7 @@ "PredefinedType": "The type of project order.", "Status": "The current status of a project order.Examples of status values that might be used for a project order status include: - PLANNED - REQUESTED - APPROVED - ISSUED - STARTED - DELAYED - DONE" }, - "description": "The current status of a project order.Examples of status values that might be used for a project order status include: - PLANNED - REQUESTED - APPROVED - ISSUED - STARTED - DELAYED - DONE", + "description": "An IfcProjectOrder sets common properties for project orders issued in a construction or facilities management project.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedmgmtelements/lexical/ifcprojectorder.htm" }, "IfcProjectOrderRecord": { @@ -3030,7 +3030,7 @@ "PredefinedType": "Identifies the type of project incident.", "Records": "Records in the sequence of occurrence the incident of a project order and the objects that are related to that project order. For instance, a maintenance incident will connect a work order with the objects (elements or assets) that are subject to the provisions of the work order" }, - "description": "Identifies the type of project incident.", + "description": "An IfcProjectOrderRecord records information in sequence about the incidence of each order that is connected with one or a set of objects.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedmgmtelements/lexical/ifcprojectorderrecord.htm" }, "IfcProjectionCurve": { @@ -3049,7 +3049,7 @@ "PropertyDependsOn": "The relating property on which the value of the property depends.", "PropertyForDependance": "The property on whose value that of another property depends." }, - "description": "Reference to the IfcComplexProperty in which the IfcProperty is contained.", + "description": "An abstract generalization for all types of properties that can be associated with IFC objects through the property set mechanism.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcproperty.htm" }, "IfcPropertyBoundedValue": { @@ -3058,7 +3058,7 @@ "Unit": "Unit for the upper and lower bound values, if not given, the default value for the measure type (given by the TYPE of the upper and lower bound values) is used as defined by the global unit assignment at IfcProject.", "UpperBoundValue": "Upper bound value for the interval defining the property value. If the value is not given, it indicates an open bound (all values to be greater than or equal to LowerBoundValue)." }, - "description": "Unit for the upper and lower bound values, if not given, the default value for the measure type (given by the TYPE of the upper and lower bound values) is used as defined by the global unit assignment at IfcProject.", + "description": "A property with a bounded value (IfcPropertyBoundedValue) defines a property object which has a maximum of two (numeric or descriptive) values assigned, the first value specifying the upper bound and the second value specifying the lower bound. It defines a property - value bound (min-max) combination for which the property name, the upper bound value with measure type, the lower bound value with measure type (and optional the unit) is given.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertyboundedvalue.htm" }, "IfcPropertyConstraintRelationship": { @@ -3068,14 +3068,14 @@ "RelatedProperties": "The properties to which a constraint is to be related.", "RelatingConstraint": "The constraint that is to be related." }, - "description": "A description that may apply additional information about a property constraint relationship.", + "description": "An IfcPropertyConstraintRelationship is a relationship class that enables a constraint to be related to one or more properties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstraintresource/lexical/ifcpropertyconstraintrelationship.htm" }, "IfcPropertyDefinition": { "attributes": { "HasAssociations": "Reference to the relationship IfcRelAssociates and thus to those externally defined concepts, like classifications, documents, or library information, which are associated to the property definition." }, - "description": "Reference to the relationship IfcRelAssociates and thus to those externally defined concepts, like classifications, documents, or library information, which are associated to the property definition.", + "description": "The IfcPropertyDefinition defines the generalization of all characteristics (i.e. a grouping of individual properties), that may be assigned to objects. Currently, subtypes of IfcPropertyDefinition include property set definitions, and property sets..", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcpropertydefinition.htm" }, "IfcPropertyDependencyRelationship": { @@ -3086,7 +3086,7 @@ "Expression": "Expression that further describes the nature of the dependency relation.", "Name": "Name of the relationship that provides additional meaning to the nature of the dependency." }, - "description": "Expression that further describes the nature of the dependency relation.", + "description": "An IfcPropertyDependencyRelationship describes an identified dependency between the value of one property and that of another.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertydependencyrelationship.htm" }, "IfcPropertyEnumeratedValue": { @@ -3094,7 +3094,7 @@ "EnumerationReference": "Enumeration from which a enumeration value has been selected. The referenced enumeration also establishes the unit of the enumeration value.", "EnumerationValues": "Enumeration values, which shall be listed in the referenced IfcPropertyEnumeration, if such a reference is provided." }, - "description": "Enumeration from which a enumeration value has been selected. The referenced enumeration also establishes the unit of the enumeration value.", + "description": "A property with an enumerated value (IfcPropertyEnumeratedValue) defines a property object which has a value assigned which is chosen from an enumeration. It defines a property - value combination for which the property name, the value with measure type (and optional the unit) are given.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertyenumeratedvalue.htm" }, "IfcPropertyEnumeration": { @@ -3103,7 +3103,7 @@ "Name": "Name of this enumeration.", "Unit": "Unit for the enumerator values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." }, - "description": "Unit for the enumerator values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject.", + "description": "A collection of simple or measure values that define a prescribed set of alternatives from which 'enumeration values' are selected. This enables inclusion of enumeration values in property sets. IfcPropertyEnumeration provides a name for the enumeration as well as a list of unique (numeric or descriptive) values (that may have a measure type assigned). The entity defines the list of potential enumerators to be exchanged together (or separately) with properties of type IfcPropertyEnumeratedValue that selects their actual property values from this enumeration.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertyenumeration.htm" }, "IfcPropertyListValue": { @@ -3111,7 +3111,7 @@ "ListValues": "List of values.", "Unit": "Unit for the list values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." }, - "description": "Unit for the list values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject.", + "description": "An IfcPropertyListValue defines a property that has several (numeric or descriptive) values assigned, these values are given by an ordered list.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertylistvalue.htm" }, "IfcPropertyReferenceValue": { @@ -3119,14 +3119,14 @@ "PropertyReference": "Reference to another entity through one of the select types in IfcObjectReferenceSelect.", "UsageName": "Description of the use of the referenced value within the property." }, - "description": "Reference to another entity through one of the select types in IfcObjectReferenceSelect.", + "description": "The IfcPropertyReferenceValue allows a property value to be given by referencing other entities within the resource definitions of IFC. Those other entities are regarded as predefined complex properties and can be aggregated within a property set (IfcPropertySet). The allowable entities to be used as value references are given by the IfcObjectReferenceSelect.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertyreferencevalue.htm" }, "IfcPropertySet": { "attributes": { "HasProperties": "Contained set of properties. For property sets defined as part of the IFC Object model, the property objects within a property set are defined as part of the standard. If a property is not contained within the set of predefined properties, its value has not been set at this time." }, - "description": "Contained set of properties. For property sets defined as part of the IFC Object model, the property objects within a property set are defined as part of the standard. If a property is not contained within the set of predefined properties, its value has not been set at this time.", + "description": "The IfcPropertySet defines all dynamically extensible properties. The property set is a container class that holds properties within a property tree. These properties are interpreted according to their name attribute.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcpropertyset.htm" }, "IfcPropertySetDefinition": { @@ -3134,15 +3134,15 @@ "DefinesType": "The property style to which the property set might belong.", "PropertyDefinitionOf": "Reference to the relation to one or many objects that are characterized by the property definition. The reference may be omitted, if the property definition is used to define a style library and no instances, to which the particular style of property set is associated, exist yet." }, - "description": "The property style to which the property set might belong.", + "description": "An IfcPropertySetDefinition is a generalization of property sets, that are either:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcpropertysetdefinition.htm" }, "IfcPropertySingleValue": { "attributes": { - "NominalValue": "Value and measure type of this property. > NOTE  By virtue of the defined data type, that is selected from the SELECT IfcValue, the appropriate unit can be found within the IfcUnitAssignment, defined for the project if no value for the unit attribute is given.
IFC2x Edition 3 CHANGE  The attribute has been made optional with upward compatibility for file based exchange. ", + "NominalValue": "Value and measure type of this property. > NOTE By virtue of the defined data type, that is selected from the SELECT IfcValue, the appropriate unit can be found within the IfcUnitAssignment, defined for the project if no value for the unit attribute is given.", "Unit": "Unit for the nominal value, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." }, - "description": "Unit for the nominal value, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject.", + "description": "A property with a single value (IfcPropertySingleValue) defines a property object which has a single (numeric or descriptive) value assigned. It defines a property - single value combination for which the property name, the value with measure type (and optionally the unit) is given.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertysinglevalue.htm" }, "IfcPropertyTableValue": { @@ -3153,14 +3153,14 @@ "DefiningValues": "List of defining values, which determine the defined values.", "Expression": "Expression for the derivation of defined values from the defining values, the expression is given for information only, i.e. no automatic processing can be expected from the expression." }, - "description": "Unit for the defined values, if not given, the default value for the measure type (given by the TYPE of the defined values) is used as defined by the global unit assignment at IfcProject.", + "description": "A property with a range value (IfcPropertyTableValue) defines a property object which has two lists of (numeric or descriptive) values assigned, the values specifying a table with two columns. The defining values provide the first column and establish the scope for the defined values (the second column). Interpolations are out of scope of the IfcPropertyTableValue. An optional Expression attribute may give the equation used for deriving the range value, which is for information purposes only.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpropertyresource/lexical/ifcpropertytablevalue.htm" }, "IfcProtectiveDeviceType": { "attributes": { "PredefinedType": "Identifies the predefined types of protective device from which the type required may be set." }, - "description": "Identifies the predefined types of protective device from which the type required may be set.", + "description": "An IfcProtectiveDeviceType is a device that breaks an electrical circuit when a stated electric current that passes through it is exceeded.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcprotectivedevicetype.htm" }, "IfcProxy": { @@ -3168,56 +3168,56 @@ "ProxyType": "High level (and only) semantic meaning attached to the IfcProxy, defining the basic construct type behind the Proxy, e.g. Product or Process.", "Tag": "The tag (or label) identifier at the particular instance of a product, e.g. the serial number, or the position number. It is the identifier at the occurrence level." }, - "description": "The tag (or label) identifier at the particular instance of a product, e.g. the serial number, or the position number. It is the identifier at the occurrence level.", + "description": "The IfcProxy is intended to be a kind of a container for wrapping objects which are defined by associated properties, which may or may not have a geometric representation and placement in space. A proxy may have a semantic meaning, defined by the Name attribute, and property definitions, attached through the property assignment relationship, which definition may be outside of the definitions given by the current release of IFC.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcproxy.htm" }, "IfcPumpType": { "attributes": { "PredefinedType": "Defines the type of pump typically used in building services." }, - "description": "Defines the type of pump typically used in building services.", + "description": "The element type IfcPumpType defines a list of commonly shared property set definitions of a pump and an optional set of product representations. It is used to define a pump specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcpumptype.htm" }, "IfcQuantityArea": { "attributes": { "AreaValue": "Area measure value of this quantity." }, - "description": "Area measure value of this quantity.", + "description": "A physical quantity, IfcQuantityArea, that defines a derived area measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantityarea.htm" }, "IfcQuantityCount": { "attributes": { "CountValue": "Count measure value of this quantity." }, - "description": "Count measure value of this quantity.", + "description": "An physical quantity, IfcQuantityCount, that defines a derived count measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantitycount.htm" }, "IfcQuantityLength": { "attributes": { "LengthValue": "Length measure value of this quantity." }, - "description": "Length measure value of this quantity.", + "description": "A physical quantity, IfcQuantityLength, that defines a derived length measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantitylength.htm" }, "IfcQuantityTime": { "attributes": { "TimeValue": "Time measure value of this quantity." }, - "description": "Time measure value of this quantity.", + "description": "An element quantity that defines a time measure to provide an property of time related to an element. It is normally given by the recipe information of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantitytime.htm" }, "IfcQuantityVolume": { "attributes": { "VolumeValue": "Volume measure value of this quantity." }, - "description": "Volume measure value of this quantity.", + "description": "A physical quantity that defines a derived volume measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantityvolume.htm" }, "IfcQuantityWeight": { "attributes": { "WeightValue": "Mass measure value of this quantity." }, - "description": "Mass measure value of this quantity.", + "description": "A physical element quantity that defines a derived weight measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcquantityresource/lexical/ifcquantityweight.htm" }, "IfcRadiusDimension": { @@ -3226,23 +3226,23 @@ }, "IfcRailing": { "attributes": { - "PredefinedType": "Predefined generic types for a railing that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcRailing is only permitted, if no type object IfcRailingType is assigned. > IFC2x PLATFORM CHANGE: The attribute has been changed into an OPTIONAL attribute. " + "PredefinedType": "Predefined generic types for a railing that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcRailing is only permitted, if no type object IfcRailingType is assigned." }, - "description": "Predefined generic types for a railing that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcRailing is only permitted, if no type object IfcRailingType is assigned. > IFC2x PLATFORM CHANGE: The attribute has been changed into an OPTIONAL attribute. ", + "description": "Definition of IAI: The railing is a frame assembly adjacent to human circulation spaces and at some space boundaries where it is used in lieu of walls or to complement walls. Designed to aid humans, either as an optional physical support, or to prevent injury by falling. A list of references to accessory/mounting hardware for this railing might be given by including these assessories (IfcDiscreteAssessory) through the objectified relationship IfcRelAggregates.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcrailing.htm" }, "IfcRailingType": { "attributes": { "PredefinedType": "Identifies the predefined types of a railing element from which the type required may be set." }, - "description": "Identifies the predefined types of a railing element from which the type required may be set.", + "description": "The element type (IfcRailingType) defines a list of commonly shared property set definitions of a railing element and an optional set of product representations. It is used to define a railing specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcrailingtype.htm" }, "IfcRamp": { "attributes": { "ShapeType": "Predefined shape types for a ramp that are specified in an Enum." }, - "description": "Predefined shape types for a ramp that are specified in an Enum.", + "description": "Definition from ISO 6707-1:1989: Inclined way or floor joining two surfaces at different levels.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcramp.htm" }, "IfcRampFlight": { @@ -3253,7 +3253,7 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a ramp flight element from which the type required may be set." }, - "description": "Identifies the predefined types of a ramp flight element from which the type required may be set.", + "description": "The element type (IfcRampFlightType) defines a list of commonly shared property set definitions of a ramp flight and an optional set of product representations. It is used to define an ramp flight specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcrampflighttype.htm" }, "IfcRationalBezierCurve": { @@ -3261,7 +3261,7 @@ "Weights": "The array of weights associated with the control points. This is derived from the weights data. IfcListToArray(WeightsData,0,SELF\\IfcBSplineCurve.UpperIndexOnControlPoints)", "WeightsData": "The supplied values of the weights." }, - "description": "The array of weights associated with the control points. This is derived from the weights data. IfcListToArray(WeightsData,0,SELF\\IfcBSplineCurve.UpperIndexOnControlPoints)", + "description": "A rational Bezier curve is a B-spline curve described in terms of control points and basic functions. It describes weights in addition to the control points defined at the supertype IfcBSplineCurve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcrationalbeziercurve.htm" }, "IfcRectangleHollowProfileDef": { @@ -3270,7 +3270,7 @@ "OuterFilletRadius": "Radius of the circular arcs, by which all four corners of the outer contour of rectangle are equally rounded. If not given, zero (= no rounding arcs) applies.", "WallThickness": "Thickness of the material." }, - "description": "Radius of the circular arcs, by which all four corners of the outer contour of rectangle are equally rounded. If not given, zero (= no rounding arcs) applies.", + "description": "Definition from IAI: The IfcRectangleHollowProfileDef defines a section profile that provides the defining parameters of a rectangular (or square) hollow section to be used by the swept surface geometry or the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. A square hollow section can be defined by equal values for h and b. The centre of the position coordinate system is in the profiles centre of the bounding box (for symmetric profiles identical with the centre of gravity). Normally, the longer sides are parallel to the y-axis, the shorter sides parallel to the x-axis.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcrectanglehollowprofiledef.htm" }, "IfcRectangleProfileDef": { @@ -3278,7 +3278,7 @@ "XDim": "The extent of the rectangle in the direction of the x-axis.", "YDim": "The extent of the rectangle in the direction of the y-axis." }, - "description": "The extent of the rectangle in the direction of the y-axis.", + "description": "Definition from IAI: The IfcRectangleProfileDef defines a rectangle as the profile definition used by the swept surface geometry or the swept area solid. It is given by its X extent and its Y extent, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcrectangleprofiledef.htm" }, "IfcRectangularPyramid": { @@ -3287,7 +3287,7 @@ "XLength": "The length of the base measured along the placement X axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[1]_.", "YLength": "The length of the base measured along the placement Y axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[2]_." }, - "description": "The height of the apex above the plane of the base, measured in the direction of the placement Z axis, the _SELF\\IfcCsgPrimitive3D.Position.P[2]_.", + "description": "Definition from ISO 10303-42:ed.2, 2000: A rectangular pyramid is a solid pyramid with a rectangular base. The apex of the pyramid is directly above the centre point of the base. The rectangular pyramid is specified by its position, which provides a placement coordinate system, its length, depth and height.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcrectangularpyramid.htm" }, "IfcRectangularTrimmedSurface": { @@ -3301,7 +3301,7 @@ "V2": "Second v parametric value.", "Vsense": "Flag to indicate whether the direction of the second parameter of the trimmed surface agrees with or opposes the sense of v in the basis surface." }, - "description": "BasisSurface.Dim", + "description": "Definition from ISO/CD 10303-42:1992: The trimmed surface is a simple bounded surface in which the boundaries are the constant parametric lines u~1~ = u1, u~2~ = u2, v~1~ = v1 and v~2~ = v2. All these values shall be within the parametric range of the referenced surface. Cyclic properties of the parameter range are assumed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcrectangulartrimmedsurface.htm" }, "IfcReferencesValueDocument": { @@ -3311,7 +3311,7 @@ "ReferencedDocument": "A document such as a price list or quotation from which costs are obtained.", "ReferencingValues": "Costs obtained from a single document such as a price list or quotation." }, - "description": "A description of the relationship to the document from which values may be referenced.", + "description": "An IfcReferencesValueDocument is a means of referencing many instances of IfcAppliedValue to a single document where the document is a price list, quotation, list of environmental impact values or other source of information.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccostresource/lexical/ifcreferencesvaluedocument.htm" }, "IfcRegularTimeSeries": { @@ -3319,7 +3319,7 @@ "TimeStep": "A duration of time intervals between values.", "Values": "The collection of time series values." }, - "description": "The collection of time series values.", + "description": "In a regular time series, the data arrives predictably at predefined intervals. In a regular time series there is no need to store multiple time stamps and the algorithms for analyzing the time series are therefore significantly simpler. Using the start time provided in the supertype, the time step is used to identify the frequency of the occurrences of the list of values.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifcregulartimeseries.htm" }, "IfcReinforcementBarProperties": { @@ -3331,7 +3331,7 @@ "SteelGrade": "The nominal steel grade defined according to local standards.", "TotalCrossSectionArea": "The total effective cross-section area of the reinforcement of a specific steel grade." }, - "description": "The number of bars with identical nominal diameter and steel grade included in the specific reinforcement configuration.", + "description": "An IfcReinforcementProperties defines the set of properties for a specific combination of reinforcement bar steel grade, bar type and effective depth.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcreinforcementbarproperties.htm" }, "IfcReinforcementDefinitionProperties": { @@ -3339,7 +3339,7 @@ "DefinitionType": "Descriptive type name applied to reinforcement definition properties.", "ReinforcementSectionDefinitions": "The list of section reinforcement properties attached to the reinforcement definition properties." }, - "description": "The list of section reinforcement properties attached to the reinforcement definition properties.", + "description": "An IfcReinforcementDefinitionProperties defines the cross section properties of reinforcement included in reinforced concrete building elements. The property set definition may be used both in conjunction with insitu and precast structures.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcreinforcementdefinitionproperties.htm" }, "IfcReinforcingBar": { @@ -3350,14 +3350,14 @@ "CrossSectionArea": "The effective cross-section area of the reinforcing bar.", "NominalDiameter": "The nominal diameter defining the cross-section size of the reinforcing bar." }, - "description": "Indicator for whether the bar surface is plain or textured.", + "description": "A steel bar, usually with manufactured deformations in the surface, used in concrete and masonry construction to provide additional strength.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcreinforcingbar.htm" }, "IfcReinforcingElement": { "attributes": { "SteelGrade": "The nominal steel grade defined according to local standards." }, - "description": "The nominal steel grade defined according to local standards.", + "description": "Bars, wires, strands, and other slender members embedded in concrete in such a manner that the reinforcement and the concrete act together in resisting forces.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcreinforcingelement.htm" }, "IfcReinforcingMesh": { @@ -3371,7 +3371,7 @@ "TransverseBarNominalDiameter": "The nominal diameter denoting the cross-section size of the transverse bars.", "TransverseBarSpacing": "The spacing between the transverse bars. Note: an even distribution of bars is presumed; other cases are handled by Psets." }, - "description": "The spacing between the transverse bars. Note: an even distribution of bars is presumed; other cases are handled by Psets.", + "description": "A series of longitudinal and transverse wires or bars of various gauges, arranged at right angles to each other and welded at all points of intersection; usually used for concrete slab reinforcement. Also known as welded wire fabric.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifcreinforcingmesh.htm" }, "IfcRelAggregates": { @@ -3383,14 +3383,14 @@ "RelatedObjects": "Related objects, which are assigned to a single object. The type of the single (or relating) object is defined in the subtypes of IfcRelAssigns.", "RelatedObjectsType": "Particular type of the assignment relationship. It can constrain the applicable object types, used within the role of RelatedObjects." }, - "description": "Particular type of the assignment relationship. It can constrain the applicable object types, used within the role of RelatedObjects.", + "description": "The assignment relationship, IfcRelAssigns, is a generalization of \"link\" relationships among instances of IfcObject and its various 1^st^ level subtypes. A link denotes the specific association through which one object (the client) applies the services of other objects (the suppliers), or through which one object may navigate to other objects.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassigns.htm" }, "IfcRelAssignsTasks": { "attributes": { "TimeForTask": "Contained object for the time related information for the work schedule element." }, - "description": "Contained object for the time related information for the work schedule element.", + "description": "An IfcRelAssignsTasks is a relationship class that assigns an IfcTask to an IfcWorkControl. The assignment is further qualified by attaching an IfcScheduleTimeControl to the assignment to give the time constraints of the work task, when assigned to a work plan or schedule.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprocessextension/lexical/ifcrelassignstasks.htm" }, "IfcRelAssignsToActor": { @@ -3398,21 +3398,21 @@ "ActingRole": "Role of the actor played within the context of the assignment to the object(s).", "RelatingActor": "Reference to the information about the actor. It comprises the information about the person or organization and its addresses." }, - "description": "Role of the actor played within the context of the assignment to the object(s).", + "description": "This objectified relationship (IfcRelAssignsToActor) handles the assignment of objects (subtypes of IfcObject) to an actor (subtypes of IfcActor).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstoactor.htm" }, "IfcRelAssignsToControl": { "attributes": { "RelatingControl": "Reference to the control that applies an control about objects." }, - "description": "Reference to the control that applies an control about objects.", + "description": "This objectified relationship (IfcRelAssignsToControl) handles the assignment of a control (subtype of IfcControl) to other objects (subtypes of IfcObject, with the exception of controls).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstocontrol.htm" }, "IfcRelAssignsToGroup": { "attributes": { "RelatingGroup": "Reference to group that finally contains all assigned group members." }, - "description": "Reference to group that finally contains all assigned group members.", + "description": "This objectified relationship (IfcRelAssignsToGroup) handles the assignment of objects (subtypes of IfcObject) to a group (subtypes of IfcGroup).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstogroup.htm" }, "IfcRelAssignsToProcess": { @@ -3420,14 +3420,14 @@ "QuantityInProcess": "Quantity of the object specific for the operation by this process.", "RelatingProcess": "Reference to the process to which the objects are assigned to." }, - "description": "Quantity of the object specific for the operation by this process.", + "description": "This objectified relationship (IfcRelAssignsToProcess) handles the assignment of an object as an item the process operates on. Process is related to the product that it operate on (normally as input or output) through this relationship. Processes can operate on things other than products, and can operate in ways other than input and output.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstoprocess.htm" }, "IfcRelAssignsToProduct": { "attributes": { "RelatingProduct": "Reference to the Product to which the objects are assigned to." }, - "description": "Reference to the Product to which the objects are assigned to.", + "description": "This objectified relationship IfcRelAssignsToProduct handles the assignment of objects (subtypes of IfcObject) to a product (subtypes of IfcProduct).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstoproduct.htm" }, "IfcRelAssignsToProjectOrder": { @@ -3438,35 +3438,35 @@ "attributes": { "RelatingResource": "Reference to the resource to which the objects are assigned to." }, - "description": "Reference to the resource to which the objects are assigned to.", + "description": "This objectified relationship (IfcRelAssignsToResource) handles the assignment of objects (subtypes of IfcObject) to a resource (subtypes of IfcResource).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassignstoresource.htm" }, "IfcRelAssociates": { "attributes": { "RelatedObjects": "Objects or Types, to which the external references or information is associated." }, - "description": "Objects or Types, to which the external references or information is associated.", + "description": "The association relationship (IfcRelAssociates) refer to external sources of information (most notably a classification, library or document). There is no dependency implied by the association.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassociates.htm" }, "IfcRelAssociatesAppliedValue": { "attributes": { "RelatingAppliedValue": "" }, - "description": "", + "description": "An IfcRelAssociatesAppliedValue is a subtype of IfcRelAssociates that enables the association of an instance of IfcAppliedValue with one or more instances of IfcObject.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedmgmtelements/lexical/ifcrelassociatesappliedvalue.htm" }, "IfcRelAssociatesApproval": { "attributes": { "RelatingApproval": "Reference to approval that is being applied using this relationship." }, - "description": "Reference to approval that is being applied using this relationship.", + "description": "The entity IfcRelAssociatesApproval is used to apply approval information defined by IfcApproval, in IfcApprovalResource schema, to all subtypes of IfcRoot.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccontrolextension/lexical/ifcrelassociatesapproval.htm" }, "IfcRelAssociatesClassification": { "attributes": { "RelatingClassification": "Classification applied to the objects." }, - "description": "Classification applied to the objects.", + "description": "This objectified relationship (IfcRelAssociatesClassification) handles the assignment of a classification object (items of the select IfcClassificationSelect) to objects (subtypes of IfcObject).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassociatesclassification.htm" }, "IfcRelAssociatesConstraint": { @@ -3474,37 +3474,37 @@ "Intent": "The intent of the constraint usage with regard to its related IfcConstraint and IfcObjects, IfcPropertyDefinitions or IfcRelationships. Typical values can be e.g. RATIONALE or EXPECTED PERFORMANCE.", "RelatingConstraint": "Reference to constraint that is being applied using this relationship." }, - "description": "Reference to constraint that is being applied using this relationship.", + "description": "The entity IfcRelAssociatesConstraint is used to apply constraint information defined by IfcConstraint, in IfcConstraintResource schema, to all subtypes of IfcRoot.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccontrolextension/lexical/ifcrelassociatesconstraint.htm" }, "IfcRelAssociatesDocument": { "attributes": { "RelatingDocument": "Document information or reference which is applied to the objects." }, - "description": "Document information or reference which is applied to the objects.", + "description": "This objectified relationship (IfcRelAssociatesDocument) handles the assignment of a document information (items of the select IfcDocumentSelect) to objects (subtypes of IfcObject).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassociatesdocument.htm" }, "IfcRelAssociatesLibrary": { "attributes": { "RelatingLibrary": "Reference to a library, from which the definition of the property set is taken." }, - "description": "Reference to a library, from which the definition of the property set is taken.", + "description": "This objectified relationship (IfcRelAssociatesLibrary) handles the assignment of a library item (items of the select IfcLibrarySelect) to objects (subtypes of IfcObject).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelassociateslibrary.htm" }, "IfcRelAssociatesMaterial": { "attributes": { "RelatingMaterial": "Material definition (either a single material, a list of materials, or a set of material layers) assigned to the elements." }, - "description": "Material definition (either a single material, a list of materials, or a set of material layers) assigned to the elements.", + "description": "Objectified relationship between a material definition and elements or element types to which this material definition applies. The material definition can be:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelassociatesmaterial.htm" }, "IfcRelAssociatesProfileProperties": { "attributes": { - "ProfileOrientation": "The provision of an plane angle or a direction as the measure to orient the profile definition within the elements coordinate system. * For _IfcStructuralCurveMember_ the _IfcPlaneAngleMeasure_ defines the β angle, for columns the derivation from the structural x axis and for beams the derivation from the structural z axis. The _IfcDirection_ precisely defines the orientation of the profile's structural z axis within the structural coordinate system of the analysis model. > IFC2x Edition 3 CHANGE  The attribute ProfileOrientation is a new attribute. ", + "ProfileOrientation": "The provision of an plane angle or a direction as the measure to orient the profile definition within the elements coordinate system. * For _IfcStructuralCurveMember_ the _IfcPlaneAngleMeasure_ defines the \u03b2 angle, for columns the derivation from the structural x axis and for beams the derivation from the structural z axis. The _IfcDirection_ precisely defines the orientation of the profile's structural z axis within the structural coordinate system of the analysis model.", "ProfileSectionLocation": "Reference to a shape aspect with a single member of the ShapeRepresentations list. This member holds the location at which the profile properties apply.", "RelatingProfileProperties": "Profile property definition assigned to the instances." }, - "description": "The provision of an plane angle or a direction as the measure to orient the profile definition within the elements coordinate system. * For _IfcStructuralCurveMember_ the _IfcPlaneAngleMeasure_ defines the β angle, for columns the derivation from the structural x axis and for beams the derivation from the structural z axis. The _IfcDirection_ precisely defines the orientation of the profile's structural z axis within the structural coordinate system of the analysis model. > IFC2x Edition 3 CHANGE  The attribute ProfileOrientation is a new attribute. ", + "description": "Definition from IAI: The IfcRelAssociatesProfileProperties is an objectified relationship between non geometric profile properties (subtypes of IfcProfileProperties) and elements to which these properties apply, e.g. building elements and building element types as used within the structural engineering domain for steel, timber or concrete structures.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcrelassociatesprofileproperties.htm" }, "IfcRelConnects": { @@ -3517,7 +3517,7 @@ "RelatedElement": "Reference to an Element that is connected by the objectified relationship.", "RelatingElement": "Reference to an Element that is connected by the objectified relationship." }, - "description": "Reference to an Element that is connected by the objectified relationship.", + "description": "The IfcRelConnectsElements objectified relationship provides the generalization of the connectivity between elements. It is a 1 to 1 relationship. The concept of two elements being physically or logically connected is described independently from the connecting elements. The connectivity may be related to the shape representation of the connected entities by providing a connection geometry.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelconnectselements.htm" }, "IfcRelConnectsPathElements": { @@ -3527,7 +3527,7 @@ "RelatingConnectionType": "Indication of the connection type in relation to the path of the RelatingObject.", "RelatingPriorities": "Priorities for connection. It refers to the layers of the RelatingObject." }, - "description": "Indication of the connection type in relation to the path of the RelatingObject.", + "description": "The IfcRelConnectsPathElements relationship provides the connectivity information between two elements, which have a path information. Currently it is applied to IfcWall and IfcWallStandardCase.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcrelconnectspathelements.htm" }, "IfcRelConnectsPortToElement": { @@ -3535,7 +3535,7 @@ "RelatedElement": "Reference to an Element that is connected by the objectified relationship.", "RelatingPort": "Reference to an Port that is connected by the objectified relationship." }, - "description": "Reference to an Element that is connected by the objectified relationship.", + "description": "An IfcRelConnectsPortToElement defines the relationship that is made between a port and the IfcElement in which it is contained. It is a 1 to 1 relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelconnectsporttoelement.htm" }, "IfcRelConnectsPorts": { @@ -3544,7 +3544,7 @@ "RelatedPort": "Reference to the second port that is connected by the objectified relationship.", "RelatingPort": "Reference to the first port that is connected by the objectified relationship." }, - "description": "Defines the element that realizes a port connection relationship.", + "description": "An IfcRelConnectsPorts defines the relationship that is made between two ports at their point of connection. It may include the connection geometry between two ports.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelconnectsports.htm" }, "IfcRelConnectsStructuralActivity": { @@ -3552,7 +3552,7 @@ "RelatedStructuralActivity": "Reference to an instance of IfcStructuralActivity (or its subclasses) which is acting upon the specified structural element (represented by a respective structural representation entity).", "RelatingElement": "Reference to an instance of IfcStructuralItem or IfcBuildingElement (or its subclasses) to which the specified action is applied." }, - "description": "Reference to an instance of IfcStructuralActivity (or its subclasses) which is acting upon the specified structural element (represented by a respective structural representation entity).", + "description": "The IfcRelConnectsStructuralActivity relationship connects a structural activity (either an action or reaction) to a structural member or a building element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcrelconnectsstructuralactivity.htm" }, "IfcRelConnectsStructuralElement": { @@ -3560,26 +3560,26 @@ "RelatedStructuralMember": "The structural member that is associated with the element of which it represents the analytical idealization.", "RelatingElement": "The physical element, representing a design or detailing part, that is connected to the structural member as its (partial) analytical idealization." }, - "description": "The structural member that is associated with the element of which it represents the analytical idealization.", + "description": "The one-to-one relationship assigns a structural member (as instance of IfcStructuralMember or its subclasses) to a physical element (as instance of IfcElement or its subclasses) to keep the association between the design or detailing element and the structural analysis element. ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcrelconnectsstructuralelement.htm" }, "IfcRelConnectsStructuralMember": { "attributes": { "AdditionalConditions": "Reference to instances describing additional connection properties.", - "AppliedCondition": "Reference to an instance of _IfcBoundaryCondition_ which is used to define the connections properties. > NOTE  The boundary condition applied to a member-connection-relationship is also called \"release\"", + "AppliedCondition": "Reference to an instance of _IfcBoundaryCondition_ which is used to define the connections properties. > NOTE The boundary condition applied to a member-connection-relationship is also called \"release\"", "ConditionCoordinateSystem": "Defines a new coordinate system used for the description of the connection properties. The usage of this coordinate system is described more detailed in the definition of the subtypes of this entity definition.", "RelatedStructuralConnection": "Reference to an instance of IfcStructuralConnection (or its subclasses) which is connected to the specified structural member.", "RelatingStructuralMember": "Reference to an instance of IfcStructuralMember (or its subclasses) which is connected to the specified structural connection.", "SupportedLength": "Defines the 'supported length' of this structural connection. See Fig. for more detail." }, - "description": "Defines a new coordinate system used for the description of the connection properties. The usage of this coordinate system is described more detailed in the definition of the subtypes of this entity definition.", + "description": "The entity IfcRelConnectsStructuralMember defines all needed properties describing the connection between structural members and structural connections (nodes or supports).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcrelconnectsstructuralmember.htm" }, "IfcRelConnectsWithEccentricity": { "attributes": { "ConnectionConstraint": "The connection constraint explicitly states the eccentricity between a structural element and a structural connection, either given by two point (used to calculate the eccentricity), or by explicit x, y, and z offsets." }, - "description": "The connection constraint explicitly states the eccentricity between a structural element and a structural connection, either given by two point (used to calculate the eccentricity), or by explicit x, y, and z offsets.", + "description": "The entity IfcRelConnectsWithEccentricity adds the definition of eccentricity to the connection between a structural member and a structural connection (representing either a node or support). ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcrelconnectswitheccentricity.htm" }, "IfcRelConnectsWithRealizingElements": { @@ -3587,15 +3587,15 @@ "ConnectionType": "The type of the connection given for informal purposes, it may include labels, like 'joint', 'rigid joint', 'flexible joint', etc.", "RealizingElements": "Defines the elements that realize a connection relationship." }, - "description": "The type of the connection given for informal purposes, it may include labels, like 'joint', 'rigid joint', 'flexible joint', etc.", + "description": "IfcRelConnectsWithRealizingElements defines a generic relationship that is made between two elements that require the realization of that relationship by means of further realizing elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelconnectswithrealizingelements.htm" }, "IfcRelContainedInSpatialStructure": { "attributes": { - "RelatedElements": "Set of ~~elements~~ products, which are contained within this level of the spatial structure hierarchy. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcElement to IfcProduct with upward compatibility ", + "RelatedElements": "Set of ~~elements~~ products, which are contained within this level of the spatial structure hierarchy.", "RelatingStructure": "Spatial structure element, within which the element is contained. Any element can only be contained within one element of the project spatial structure." }, - "description": "Spatial structure element, within which the element is contained. Any element can only be contained within one element of the project spatial structure.", + "description": "This objectified relationship, IfcRelContainedInSpatialStructure, is used to assign elements to a certain level of the spatial project structure. Any element can only be assigned once to a certain level of the spatial structure. The question, which level is relevant for which type of element, can only be answered within the context of a particular project and might vary within the various regions.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelcontainedinspatialstructure.htm" }, "IfcRelCoversBldgElements": { @@ -3603,7 +3603,7 @@ "RelatedCoverings": "Relationship to the set of coverings at this element.", "RelatingBuildingElement": "Relationship to the element that is covered." }, - "description": "Relationship to the set of coverings at this element.", + "description": "The IfcRelCoversBldgElements is an objectified relationship between an element and one to many coverings, which cover the building element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelcoversbldgelements.htm" }, "IfcRelCoversSpaces": { @@ -3611,7 +3611,7 @@ "RelatedCoverings": "Relationship to the set of coverings covering this space.", "RelatedSpace": "Relationship to the space object that is covered." }, - "description": "Relationship to the set of coverings covering this space.", + "description": "The objectified relationship, IfcRelCoversSpace, relates a space object to one or many coverings, which faces (or is assigned to) the space.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelcoversspaces.htm" }, "IfcRelDecomposes": { @@ -3619,36 +3619,36 @@ "RelatedObjects": "The objects being nested or aggregated.", "RelatingObject": "The object that represents the nest or aggregation." }, - "description": "The objects being nested or aggregated.", + "description": "The decomposition relationship, IfcRelDecomposes, defines the general concept of elements being composed or decomposed. The decomposition relationship denotes a whole/part hierarchy with the ability to navigate from the whole (the composition) to the parts and vice versa.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcreldecomposes.htm" }, "IfcRelDefines": { "attributes": { "RelatedObjects": "Reference to the objects (or single object) to which the property definition applies." }, - "description": "Reference to the objects (or single object) to which the property definition applies.", + "description": "A definition relationship (IfcRelDefines) that uses a type definition or property set definition (seens as partial type information) to define the properties of the object instance. It is a specific - occurrence relationship with implied dependencies (as the occurrence properties depend on the specific properties).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcreldefines.htm" }, "IfcRelDefinesByProperties": { "attributes": { "RelatingPropertyDefinition": "Reference to the property set definition for that object or set of objects." }, - "description": "Reference to the property set definition for that object or set of objects.", + "description": "This objectified relationship (IfcRelDefinesByProperties) defines the relationships between property set definitions and objects. Properties are aggregated in property sets, property sets can be grouped to define an object type.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcreldefinesbyproperties.htm" }, "IfcRelDefinesByType": { "attributes": { "RelatingType": "Reference to the type (or style) information for that object or set of objects." }, - "description": "Reference to the type (or style) information for that object or set of objects.", + "description": "This objectified relationship (IfcRelDefinesByType) defines the relationships between an object type and objects.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcreldefinesbytype.htm" }, "IfcRelFillsElement": { "attributes": { - "RelatedBuildingElement": "Reference to ~~building~~ element that occupies fully or partially the associated opening. > IFC2x PLATFORM CHANGE: The data type has been changed from IfcBuildingElement to IfcElement with upward compatibility for file based exchange. ", + "RelatedBuildingElement": "Reference to ~~building~~ element that occupies fully or partially the associated opening.", "RelatingOpeningElement": "Opening Element being filled by virtue of this relationship." }, - "description": "Reference to ~~building~~ element that occupies fully or partially the associated opening. > IFC2x PLATFORM CHANGE: The data type has been changed from IfcBuildingElement to IfcElement with upward compatibility for file based exchange. ", + "description": "Objectified relationship between an opening element and an ~~building~~ element that fills (or partially fills) the opening element. It is an one-to-one relationship.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelfillselement.htm" }, "IfcRelFlowControlElements": { @@ -3656,7 +3656,7 @@ "RelatedControlElements": "References control elements which may be used to impart control on the Distribution Element.", "RelatingFlowElement": "Relationship to a distribution flow element" }, - "description": "Relationship to a distribution flow element", + "description": "Objectified relationship between a distribution flow element occurrence instance and one-to-many control element occurrence instances. Currently it is applied to IfcDistributionFlowelEment and IfcDistributionControlElement.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcrelflowcontrolelements.htm" }, "IfcRelInteractionRequirements": { @@ -3667,7 +3667,7 @@ "RelatedSpaceProgram": "Related space program for the interaction requirement.", "RelatingSpaceProgram": "Relating space program for the interaction requirement." }, - "description": "Relating space program for the interaction requirement.", + "description": "The interaction requirement (IfcRelInteractionRequirements) is provided as a relationship that defines the requirements for the interaction (adjacency) of two spaces in the architectural program.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcarchitecturedomain/lexical/ifcrelinteractionrequirements.htm" }, "IfcRelNests": { @@ -3682,7 +3682,7 @@ "attributes": { "OverridingProperties": "A property set, which contains those properties, that have a different value for the subset of objects." }, - "description": "A property set, which contains those properties, that have a different value for the subset of objects.", + "description": "The objectified relationship (IfcRelOverridesProperties) defines the relationships between objects and a standard property set. It also defines a set of properties, which values override the standard values given within the standard property set.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcreloverridesproperties.htm" }, "IfcRelProjectsElement": { @@ -3690,15 +3690,15 @@ "RelatedFeatureElement": "Reference to the _IfcFeatureElementAddition_ that defines an addition to the volume of the element, by using a Boolean addition operation. An example is a projection at the associated element.", "RelatingElement": "Element at which a projection is created by the associated _IfcProjectionElement_." }, - "description": "Reference to the _IfcFeatureElementAddition_ that defines an addition to the volume of the element, by using a Boolean addition operation. An example is a projection at the associated element.", + "description": "The IfcRelProjectsElement is an objectified relationship between an element and one projection element that creates a modifier to the shape of the element. This relationship implies a Boolean operation of addition for the geometric bodies of the building element and the projection element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelprojectselement.htm" }, "IfcRelReferencedInSpatialStructure": { "attributes": { - "RelatedElements": "Set of products, which are referenced within this level of the spatial structure hierarchy. > NOTE  Referenced elements are contained elsewhere within the spatial structure, they are referenced additionally by this spatial structure element, e.g., because they span several stories.", + "RelatedElements": "Set of products, which are referenced within this level of the spatial structure hierarchy. > NOTE Referenced elements are contained elsewhere within the spatial structure, they are referenced additionally by this spatial structure element, e.g., because they span several stories.", "RelatingStructure": "Spatial structure element, within which the element is referenced. Any element can be contained within zero, one or many elements of the project spatial structure." }, - "description": "Spatial structure element, within which the element is referenced. Any element can be contained within zero, one or many elements of the project spatial structure.", + "description": "This objectified relationship, IfcRelReferencedInSpatialStructure, is used to assign elements in addition to those levels of the project spatial structure, in which they are referenced, but not primarily contained.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelreferencedinspatialstructure.htm" }, "IfcRelSchedulesCostItems": { @@ -3712,34 +3712,34 @@ "SequenceType": "The way in which the time lag applies to the sequence.", "TimeLag": "Time Duration of the sequence, it is the time lag between the predecessor and the successor as specified by the SequenceType." }, - "description": "The way in which the time lag applies to the sequence.", + "description": "This objectified relationship handles the concatenation of processes over time. The sequence is defined as relationship between two processes. The related object is the successor of the relating object, being the predecessor. A time lag is assigned to a sequence, and the sequence type defines the way in which the time lag applies to the sequence.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcrelsequence.htm" }, "IfcRelServicesBuildings": { "attributes": { - "RelatedBuildings": "Spatial structure elements (including site, building, storeys) that are serviced by the system. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcBuilding to IfcSpatialStructureElement with upward compatibility for file based exchange. ", + "RelatedBuildings": "Spatial structure elements (including site, building, storeys) that are serviced by the system.", "RelatingSystem": "System that services the Buildings." }, - "description": "Spatial structure elements (including site, building, storeys) that are serviced by the system. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcBuilding to IfcSpatialStructureElement with upward compatibility for file based exchange. ", + "description": "An objectified relationship that defines the relationship between a system and the sites, buildings, storeys or spaces, it serves. Examples of systems are:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelservicesbuildings.htm" }, "IfcRelSpaceBoundary": { "attributes": { - "ConnectionGeometry": "Physical representation of the space boundary. Provided as a **curve or** surface given within the LCS of the space. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcConnectionSurfaceGeometry to IfcConnectionGeometry with upward compatibility for file based exchange. ", + "ConnectionGeometry": "Physical representation of the space boundary. Provided as a **curve or** surface given within the LCS of the space.", "InternalOrExternalBoundary": "Defines, whether the Space Boundary is internal (Internal), or external, i.e. adjacent to open space (that can be an partially enclosed space, such as terrace (External).", "PhysicalOrVirtualBoundary": "Defines, whether the Space Boundary is physical (Physical) or virtual (Virtual).", - "RelatedBuildingElement": "Reference to ~~Building~~ Element, that defines the Space Boundaries. > IFC2x PLATFORM CHANGE: The data type has been changed from IfcBuildingElement to IfcElement with upward compatibility for file based exchange. ", + "RelatedBuildingElement": "Reference to ~~Building~~ Element, that defines the Space Boundaries.", "RelatingSpace": "Reference to one spaces that is delimited by this boundary." }, - "description": "Defines, whether the Space Boundary is internal (Internal), or external, i.e. adjacent to open space (that can be an partially enclosed space, such as terrace (External).", + "description": "The space boundary (IfcRelSpaceBoundary) defines the physical or virtual delimiter of a space as its relationship to the surrounding elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelspaceboundary.htm" }, "IfcRelVoidsElement": { "attributes": { - "RelatedOpeningElement": "Reference to the ~~opening~~ feature subtraction element which defines a void in the associated ~~opening~~ element. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcOpeningElement to IfcFeatureElementSubtraction with upward compatibility for file based exchange. ", - "RelatingBuildingElement": "Reference to ~~building~~ element in which a void is created by associated ~~opening~~ feature subtraction element. > IFC2x PLATFORM CHANGE: The data type has been changed from IfcBuildingElement to IfcElement with upward compatibility for file based exchange. " + "RelatedOpeningElement": "Reference to the ~~opening~~ feature subtraction element which defines a void in the associated ~~opening~~ element.", + "RelatingBuildingElement": "Reference to ~~building~~ element in which a void is created by associated ~~opening~~ feature subtraction element." }, - "description": "Reference to the ~~opening~~ feature subtraction element which defines a void in the associated ~~opening~~ element. > IFC2x PLATFORM CHANGE  The data type has been changed from IfcOpeningElement to IfcFeatureElementSubtraction with upward compatibility for file based exchange. ", + "description": "Objectified relationship between an ~~building~~ element and one opening element that creates a void in the element. It is a one-to-one relationship. This relationship implies a Boolean operation of subtraction between the geometric bodies of the element and the opening.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcrelvoidselement.htm" }, "IfcRelationship": { @@ -3751,20 +3751,20 @@ "InitialStress": "Stress at the beginning. Given as relative to the yield stress of the material and is therefore dimensionless.", "RelaxationValue": "Time dependent loss of stress, relative to initial stress and therefore dimensionless." }, - "description": "Stress at the beginning. Given as relative to the yield stress of the material and is therefore dimensionless.", + "description": "Measure of the decrease in stress over long time interval resulting from plastic flow. It describes the time dependent relative relaxation value for a given initial stress level at constant strain.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcrelaxation.htm" }, "IfcRepresentation": { "attributes": { "ContextOfItems": "Definition of the representation context for which the different subtypes of representation are valid.", "Items": "Set of geometric representation items that are defined for this representation.", - "LayerAssignments": "Assignment of the whole representation to a single or multiple layer(s). The _LayerAssigments_ can be overridden by _LayerAssigments_ of the _IfcRepresentationItem_'s within the list of _Items_. > NOTE  Implementation agreements can restrict the maximum number of layer assignments to 1. > IFC2x Edition 3 CHANGE  The inverse attribute LayerAssignments has been added. ", + "LayerAssignments": "Assignment of the whole representation to a single or multiple layer(s). The _LayerAssigments_ can be overridden by _LayerAssigments_ of the _IfcRepresentationItem_'s within the list of _Items_. > NOTE Implementation agreements can restrict the maximum number of layer assignments to 1.", "OfProductRepresentation": "Reference to the product shape, for which it is the shape representation.", "RepresentationIdentifier": "The optional identifier of the representation as used within a project.", - "RepresentationMap": "Use of the representation within an _IfcRepresentationMap_. If used, this _IfcRepresentation_ may be assigned to many representations as one of its _Items_ using an _IfcMappedItem_. Using _IfcRepresentationMap_ is the way to share one representation (often of type _IfcShapeRepresentation_) by many products. > IFC2x Edition 3 CHANGE  The inverse attribute LayerAssignments has been added. ", + "RepresentationMap": "Use of the representation within an _IfcRepresentationMap_. If used, this _IfcRepresentation_ may be assigned to many representations as one of its _Items_ using an _IfcMappedItem_. Using _IfcRepresentationMap_ is the way to share one representation (often of type _IfcShapeRepresentation_) by many products.", "RepresentationType": "The description of the type of a representation context. The representation type defines the type of geometry or topology used for representing the product representation. More information is given at the subtypes _IfcShapeRepresentation_ and _IfcTopologyRepresentation_. The supported values for context type are to be specified by implementers agreements." }, - "description": "Reference to the product shape, for which it is the shape representation.", + "description": "Definition from ISO/CD 10303-43:1992: A representation is one or more representation items that are related in a specified representation context as the representation of some concept.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcrepresentation.htm" }, "IfcRepresentationContext": { @@ -3773,15 +3773,15 @@ "ContextType": "The description of the type of a representation context. The supported values for context type are to be specified by implementers agreements.", "RepresentationsInContext": "All shape representations that are defined in the same representation context." }, - "description": "All shape representations that are defined in the same representation context.", + "description": "Definition from ISO/CD 10303-42:1992: A representation context is a context in which a set of representation items are related.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcrepresentationcontext.htm" }, "IfcRepresentationItem": { "attributes": { - "LayerAssignments": "Assignment of the representation item to a single or multiple layer(s). The _LayerAssignments_ can override a _LayerAssignments_ of the _IfcRepresentation_ it is used within the list of _Items_. > NOTE  Implementation agreements can restrict the maximum number of layer assignments to 1. > IFC2x Edition 3 CHANGE  The inverse attribute LayerAssignments has been added.", - "StyledByItem": "Reference to the _IfcStyledItem_ that provides presentation information to the representation, e.g. a curve style, including colour and thickness to a geometric curve. > IFC2x Edition 3 CHANGE  The inverse attribute StyledByItem has been added." + "LayerAssignments": "Assignment of the representation item to a single or multiple layer(s). The _LayerAssignments_ can override a _LayerAssignments_ of the _IfcRepresentation_ it is used within the list of _Items_. > NOTE Implementation agreements can restrict the maximum number of layer assignments to 1.", + "StyledByItem": "Reference to the _IfcStyledItem_ that provides presentation information to the representation, e.g. a curve style, including colour and thickness to a geometric curve." }, - "description": "Reference to the _IfcStyledItem_ that provides presentation information to the representation, e.g. a curve style, including colour and thickness to a geometric curve. > IFC2x Edition 3 CHANGE  The inverse attribute StyledByItem has been added.", + "description": "Definition from ISO/CD 10303-43:1992: A representation item is an element of product data that participates in one or more representations or contributes to the definition of another representation item. A representation item contributes to the definition of another representation item when it is referenced by that representation item.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcrepresentationitem.htm" }, "IfcRepresentationMap": { @@ -3790,14 +3790,14 @@ "MappedRepresentation": "A representation that is mapped to at least one mapped item.", "MappingOrigin": "An axis2 placement that defines the position about which the mapped representation is mapped." }, - "description": "", + "description": "Definition from ISO/CD 10303-43:1992: A representation map is the identification of a representation and a representation item in that representation for the purpose of mapping. The representation item defines the origin of the mapping. The representation map is used as the source of a mapping by a mapped item.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcrepresentationmap.htm" }, "IfcResource": { "attributes": { "ResourceOf": "Reference to the IfcRelAssignsToResource relationship and thus pointing to those objects, which are used as resources." }, - "description": "Reference to the IfcRelAssignsToResource relationship and thus pointing to those objects, which are used as resources.", + "description": "The IfcResource contains the information needed to represent the costs, schedule, and other impacts from the use of a thing in a process. It is not intended to use IfcResource to model the general properties of the things themselves, while an optional linkage from IfcResource to the things to be used can be specified (i.e. the relationship from subtypes of IfcResource to IfcProduct through the IfcRelAssignsToResource relationship).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcresource.htm" }, "IfcRevolvedAreaSolid": { @@ -3806,7 +3806,7 @@ "Axis": "Axis about which revolution will take place.", "AxisLine": "The line of the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(Axis.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(Axis.Z,1.0))" }, - "description": "The line of the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(Axis.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(Axis.Z,1.0))", + "description": "A revolved area solid (IfcRevolvedAreaSolid) is a solid created by revolving a planar bounded surface about an axis. Both, the axis and planar bounded surface shall be in the same plane and the axis shall not intersect the interior of the swept area. If the swept area has inner boundaries, i.e. holes defined, then those holes shall be swept into holes of the solid. The direction of revolution is clockwise when viewed along the axis in the positive direction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcrevolvedareasolid.htm" }, "IfcRibPlateProfileProperties": { @@ -3817,7 +3817,7 @@ "RibWidth": "Width of the ribs.", "Thickness": "Defines the thickness of the structural face member." }, - "description": "Defines the direction of profile definition as described on figure above.", + "description": "Instances of the entity IfcRibPlateProfileProperties shall be used for a parameterized definition of rib plates.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcribplateprofileproperties.htm" }, "IfcRightCircularCone": { @@ -3825,7 +3825,7 @@ "BottomRadius": "", "Height": "" }, - "description": "", + "description": "Definition from ISO/CD 10303-42:1992: A right circular cone is a CSG primitive in the form of a cone. It is defined by an axis, a point on the axis, (...) and a distance giving the location along the axis from the point to the base of the cone. In addition, a radius is given (...).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcrightcircularcone.htm" }, "IfcRightCircularCylinder": { @@ -3833,14 +3833,14 @@ "Height": "", "Radius": "" }, - "description": "", + "description": "Definition from ISO/CD 10303-42:1992: A right circular cylinder is a CSG primitive in the form of a solid cylinder of finite height. It is defined by an axis point at the centre of one planar circular face, an axis, a height, and a radius. The faces are perpendicular to the axis and are circular discs with the specified radius. The height is the distance from the first circular face centre in the positive direction of the axis to the second circular face centre.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcrightcircularcylinder.htm" }, "IfcRoof": { "attributes": { "ShapeType": "Predefined shape types for a roof that are specified in an enumeration." }, - "description": "Predefined shape types for a roof that are specified in an enumeration.", + "description": "Definition from ISO 6707-1:1989: Construction enclosing the building from above.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcroof.htm" }, "IfcRoot": { @@ -3850,21 +3850,21 @@ "Name": "Optional name for use by the participating software systems or users. For some subtypes of IfcRoot the insertion of the Name attribute may be required. This would be enforced by a where rule.", "OwnerHistory": "Assignment of the information about the current ownership of that object, including owning actor, application, local identification and information captured about the recent changes of the object, NOTE: only the last modification in stored." }, - "description": "Optional description, provided for exchanging informative comments.", + "description": "Definition from IAI: The IfcRoot is the most abstract and root class for all IFC entity definitions that roots in the kernel or in subsequent layers of the IFC object model. It is therefore the common supertype all all IFC entities, beside those defined in an IFC resource schema. All entities that are subtypes of IfcRoot can be used independently, whereas resource schema entities, that are not subtypes of IfcRoot, are not supposed to be independent entities.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifcroot.htm" }, "IfcRoundedEdgeFeature": { "attributes": { "Radius": "The radius of the feature cross section." }, - "description": "The radius of the feature cross section.", + "description": "An edge feature with a rounded cross section shape.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedcomponentelements/lexical/ifcroundededgefeature.htm" }, "IfcRoundedRectangleProfileDef": { "attributes": { "RoundingRadius": "Radius of the circular arcs, by which all four corners of the rectangle are equally rounded. If not given, zero (= no rounding arcs) applies." }, - "description": "Radius of the circular arcs, by which all four corners of the rectangle are equally rounded. If not given, zero (= no rounding arcs) applies.", + "description": "Definition from IAI: The IfcRoundedRectangleProfileDef defines a rectangle with equally rounded corners as the profile definition used by the swept surface geometry or the swept area solid. It is given by the X extent, the Y extent, and the radius for the rounded corners, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system, i.e. in the center of the bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcroundedrectangleprofiledef.htm" }, "IfcSIUnit": { @@ -3873,14 +3873,14 @@ "Name": "The word, or group of words, by which the SI unit is referred to.", "Prefix": "The SI Prefix for defining decimal multiples and submultiples of the unit." }, - "description": "The dimensional exponents of SI units are derived by function _IfcDimensionsForSiUnit_. IfcDimensionsForSiUnit (SELF.Name)", + "description": "Definition from ISO/CD 10303-41:1992: An SI unit is the fixed quantity used as a standard in terms of which items are measured as defined by ISO 1000 (clause 2).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcsiunit.htm" }, "IfcSanitaryTerminalType": { "attributes": { "PredefinedType": "Identifies the predefined types of sanitary terminal from which the type required may be set." }, - "description": "Identifies the predefined types of sanitary terminal from which the type required may be set.", + "description": "IfcSanitaryTerminalType defines a particular type of IfcFlowTerminal that is a fixed appliance or terminal usually supplied with water and used for drinking, cleaning or foul water disposal or that is an item of equipment directly used with such an appliance or terminal.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcplumbingfireprotectiondomain/lexical/ifcsanitaryterminaltype.htm" }, "IfcScheduleTimeControl": { @@ -3905,7 +3905,7 @@ "StatusTime": "The date or time at which the status of the tasks within the schedule is analyzed.", "TotalFloat": "The difference between the duration available to carry out a task and the scheduled duration of the task. NOTE: Total Float time may be calculated as being the difference between the scheduled duration of a task and the available duration from earliest start to latest finish. Float time may be either positive, zero or negative. Where it is zero or negative, the task becomes critical." }, - "description": "The assigned schedule time control in the relationship.", + "description": "The IfcScheduleTimeControl captures the time-related information about a process including the different types (i.e. actual, or scheduled) of starting and ending times, duration, float times, etc.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprocessextension/lexical/ifcscheduletimecontrol.htm" }, "IfcSectionProperties": { @@ -3914,7 +3914,7 @@ "SectionType": "An indicator whether a specific piece of a cross section is uniform or tapered in longitudinal direction.", "StartProfile": "The cross section profile at the start point of the longitudinal section." }, - "description": "The cross section profile at the end point of the longitudinal section.", + "description": "An IfcSectionProperties defines the cross section properties for a single longitudinal piece of a cross section.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcsectionproperties.htm" }, "IfcSectionReinforcementProperties": { @@ -3926,7 +3926,7 @@ "SectionDefinition": "Definition of the cross section profile and longitudinal section type.", "TransversePosition": "The position for the section reinforcement properties in transverse direction." }, - "description": "The set of reinforcment properties attached to a section reinforcement properties definition.", + "description": "An IfcSectionReinforcementProperties defines the cross section properties of reinforcement for a single longitudinal piece of a cross section with a specific reinforcement usage type.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcsectionreinforcementproperties.htm" }, "IfcSectionedSpine": { @@ -3936,14 +3936,14 @@ "Dim": "The dimensionality of the spine curve is always 3. 3", "SpineCurve": "A single composite curve, that defines the spine curve. Each of the composite curve segments correspond to the part between two cross-sections." }, - "description": "The dimensionality of the spine curve is always 3. 3", + "description": "Definition from ISO/DIS 10303-42-ed2:1999: A sectioned spine is a representation of the shape of a three dimensional object composed of a spine curve and a number of planar cross sections. The shape is defined between the first element of cross sections and the last element of this set.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsectionedspine.htm" }, "IfcSensorType": { "attributes": { "PredefinedType": "Identifies the predefined types of sensor from which the type required may be set." }, - "description": "Identifies the predefined types of sensor from which the type required may be set.", + "description": "An IfcSensorType defines a particular type of sensor which is used for detection in a control system such as a building automation control system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcbuildingcontrolsdomain/lexical/ifcsensortype.htm" }, "IfcServiceLife": { @@ -3951,7 +3951,7 @@ "ServiceLifeDuration": "The length or duration of a service life.", "ServiceLifeType": "Predefined service life types from which that required may be set." }, - "description": "The length or duration of a service life.", + "description": "An IfcServiceLife is the period of time that an artefact (typically a product or asset) will last.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcservicelife.htm" }, "IfcServiceLifeFactor": { @@ -3961,7 +3961,7 @@ "PredefinedType": "Predefined service life factor types from which that required may be set.", "UpperValue": "Upper of the three values assigned to the service life factor." }, - "description": "Lower of the three values assigned to the service life factor.", + "description": "An IfcServiceLifeFactor captures the various factors that impact upon the expected service life of an artefact.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedfacilitieselements/lexical/ifcservicelifefactor.htm" }, "IfcShapeAspect": { @@ -3970,16 +3970,16 @@ "Name": "The word or group of words by which the shape aspect is known. It is a tag to indicate the particular semantic of a component within the product definition shape, used to provide meaning. Example: use the tag \"Glazing\" to define which component of a window shape defines the glazing area.", "PartOfProductDefinitionShape": "Reference to the product definition shape of which this class is an aspect.", "ProductDefinitional": "An indication that the shape aspect is on the physical boundary of the product definition shape. If the value of this attribute is TRUE, it shall be asserted that the shape aspect being identified is on such a boundary. If the value is FALSE, it shall be asserted that the shape aspect being identified is not on such a boundary. If the value is UNKNOWN, it shall be asserted that it is not known whether or not the shape aspect being identified is on such a boundary. --- EXAMPLE: Would be FALSE for a center line, identified as shape aspect; would be TRUE for a cantilever. ---", - "ShapeRepresentations": "List of ~~shape~~ representations. Each member defines a valid representation of a particular type within a particular representation context as being an aspect (or part) of a product definition. > IFC2x Edition 3 CHANGE  The data type has been changed from IfcShapeRepresentation to IfcShapeModel with upward compatibility " + "ShapeRepresentations": "List of ~~shape~~ representations. Each member defines a valid representation of a particular type within a particular representation context as being an aspect (or part) of a product definition." }, - "description": "Reference to the product definition shape of which this class is an aspect.", + "description": "Definition from ISO/CD 10303-41:1992: The shape aspect is an identifiable element of the shape of a product.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcshapeaspect.htm" }, "IfcShapeModel": { "attributes": { "OfShapeAspect": "Reference to the shape aspect, for which it is the shape representation." }, - "description": "Reference to the shape aspect, for which it is the shape representation.", + "description": "The IfcShapeModel represents the concept of a particular geometric and/or topological representation of a product's shape or a product component's shape within a representation context. This representation context has to be a geometric representation context (with the exception of topology representations without associated geometry). The two subtypes are IfcShapeRepresentation to cover the geometric models (or sets) that represent a shape, and IfcTopologyRepresentation to cover the conectivity of a product or product component. The topology may or may not have geometry associated.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcrepresentationresource/lexical/ifcshapemodel.htm" }, "IfcShapeRepresentation": { @@ -3991,7 +3991,7 @@ "Dim": "The space dimensionality of this class, it is always 3. 3", "SbsmBoundary": "" }, - "description": "The space dimensionality of this class, it is always 3. 3", + "description": "Definition from ISO/CD 10303-42:1992: A shell based surface model is described by a set of open or closed shells of dimensionality 2. The shells shall not intersect except at edges and vertices. In particular, distinct faces may not intersect. A complete face of one shell may be shared with another shell. Coincident portions of shells shall both reference the same faces, edges and vertices defining the coincident region. There shall be at least one shell.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcshellbasedsurfacemodel.htm" }, "IfcSimpleProperty": { @@ -4002,25 +4002,25 @@ "attributes": { "LandTitleNumber": "The land title number (designation of the site within a regional system).", "RefElevation": "Datum elevation relative to sea level.", - "RefLatitude": "World Latitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > Latitudes are measured relative to the geodetic equator, north of the equator by positive values - from 0 till +90, south of the equator by negative values - from 0 till -90.", - "RefLongitude": "World Longitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > Longitudes are measured relative to the geodetic zero meridian, nominally the same as the Greenwich prime meridian: longitudes west of the zero meridian have positive values - from 0 till +180, longitudes east of the zero meridian have negative values - from 0 till -180.", + "RefLatitude": "World Latitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > Latitudes are measured relative to the geodetic equator, north of the equator by positive values - from 0 till +90, south of the equator by negative values - from 0 till -90.", + "RefLongitude": "World Longitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > Longitudes are measured relative to the geodetic zero meridian, nominally the same as the Greenwich prime meridian: longitudes west of the zero meridian have positive values - from 0 till +180, longitudes east of the zero meridian have negative values - from 0 till -180.", "SiteAddress": "Address given to the site for postal purposes." }, - "description": "Address given to the site for postal purposes.", + "description": "Definition from ISO 6707-1:1989: Area where construction works are undertaken.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcsite.htm" }, "IfcSlab": { "attributes": { - "PredefinedType": "Predefined generic types for a slab that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcSlab is only permitted, if no type object IfcSlabType is assigned. > IFC2x PLATFORM CHANGE: The attribute has been changed into an OPTIONAL attribute. " + "PredefinedType": "Predefined generic types for a slab that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcSlab is only permitted, if no type object IfcSlabType is assigned." }, - "description": "Predefined generic types for a slab that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE: The use of the predefined type directly at the occurrence object level of IfcSlab is only permitted, if no type object IfcSlabType is assigned. > IFC2x PLATFORM CHANGE: The attribute has been changed into an OPTIONAL attribute. ", + "description": "A slab is a component of the construction that normally encloses a space vertically. The slab may provide the lower support (floor) or upper construction (roof slab) in any space in a building. It shall be noted, that only the core or constructional part of this construction is considered to be a slab. The upper finish (flooring, roofing) and the lower finish (ceiling, suspended ceiling) are considered to be coverings. A special type of slab is the landing, described as a floor section to which one or more stair flights or ramp flights connect. May or may not be adjacent to a building storey floor.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcslab.htm" }, "IfcSlabType": { "attributes": { "PredefinedType": "Type of the slab." }, - "description": "Type of the slab.", + "description": "The element type (IfcSlabType) defines a list of commonly shared property set definitions of a slab and an optional set of product representations. It is used to define a slab specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcslabtype.htm" }, "IfcSlippageConnectionCondition": { @@ -4029,14 +4029,14 @@ "SlippageY": "Slippage of that connection. Defines the maximum displacement in y-direction without any loading applied.", "SlippageZ": "Slippage of that connection. Defines the maximum displacement in z-direction without any loading applied." }, - "description": "Slippage of that connection. Defines the maximum displacement in z-direction without any loading applied.", + "description": "Instances of the entity IfcSlippageConnectionCondition shall be used to describe connection properties needed to specify slippage.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcslippageconnectioncondition.htm" }, "IfcSolidModel": { "attributes": { "Dim": "The space dimensionality of this class, it is always 3. 3" }, - "description": "The space dimensionality of this class, it is always 3. 3", + "description": "Definition from ISO/CD 10303-42:1992: A solid model is a complete representation of the nominal shape of a product such that all points in the interior are connected. Any point can be classified as being inside, outside, or on the boundary of a solid. There are several different types of solid model representations.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsolidmodel.htm" }, "IfcSoundProperties": { @@ -4045,7 +4045,7 @@ "SoundScale": "Reference sound scale", "SoundValues": "Sound values at a specific frequency. There may be cases where less than eight values are specified." }, - "description": "Sound values at a specific frequency. There may be cases where less than eight values are specified.", + "description": "Common definition to capture the properties of sound typically used within the context of building services and flow distribution systems. Sound properties are sound power or pressure levels across eight octave bands specifying the amount of sound generation or sound attenuation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcsoundproperties.htm" }, "IfcSoundValue": { @@ -4054,24 +4054,24 @@ "SoundLevelSingleValue": "A sound pressure or sound power value. For sound pressure levels, the values are measured in decibels at a reference pressure of 20 microPascals for the referenced octave band frequency. For sound power levels, the values are measured in decibels at a reference power of 1 picowatt(10\\^(-12) watt) for the referenced octave band frequency.", "SoundLevelTimeSeries": "A time series of sound pressure or sound power values. For sound pressure levels, the values are measured in decibels at a reference pressure of 20 microPascals for the referenced octave band frequency. For sound power levels, the values are measured in decibels at a reference power of 1 picowatt(10\\^(-12) watt) for the referenced octave band frequency." }, - "description": "A sound pressure or sound power value. For sound pressure levels, the values are measured in decibels at a reference pressure of 20 microPascals for the referenced octave band frequency. For sound power levels, the values are measured in decibels at a reference power of 1 picowatt(10\\^(-12) watt) for the referenced octave band frequency.", + "description": "A sound value or time series of sound values at a specified frequency.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcsoundvalue.htm" }, "IfcSpace": { "attributes": { "BoundedBy": "Reference to Set of Space Boundaries that defines the physical or virtual delimitation of that Space.", "ElevationWithFlooring": "Level of flooring of this space; the average shall be taken, if the space ground surface is sloping or if there are level differences within this space.", - "HasCoverings": "Reference to _IfcCovering_ by virtue of the objectified relationship _IfcRelCoversSpaces_. It defines the concept of a space having coverings assigned. Those coverings may represent different flooring, or tiling areas. > NOTE  Coverings are often managed by the space, and not by the building element, which they cover.
IFC2x Edition3 CHANGE  New inverse relationship. Upward compatibility for file based exchange is guaranteed. ", + "HasCoverings": "Reference to _IfcCovering_ by virtue of the objectified relationship _IfcRelCoversSpaces_. It defines the concept of a space having coverings assigned. Those coverings may represent different flooring, or tiling areas. > NOTE Coverings are often managed by the space, and not by the building element, which they cover.", "InteriorOrExteriorSpace": "Defines, whether the Space is interior (Internal), or exterior (External), i.e. part of the outer space." }, - "description": "Reference to Set of Space Boundaries that defines the physical or virtual delimitation of that Space.", + "description": "A space represents an area or volume bounded actually or theoretically. Spaces are areas or volumes that provide for certain functions within a building.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcspace.htm" }, "IfcSpaceHeaterType": { "attributes": { "PredefinedType": "Enumeration of possible types of space heater (e.g., baseboard heater, convector, radiator, etc.)." }, - "description": "Enumeration of possible types of space heater (e.g., baseboard heater, convector, radiator, etc.).", + "description": "The element type IfcSpaceHeaterType defines a list of commonly shared property set definitions of a space heater and an optional set of product representations. It is used to define a space heater specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcspaceheatertype.htm" }, "IfcSpaceProgram": { @@ -4084,7 +4084,7 @@ "SpaceProgramIdentifier": "Identifier for this space program. It often refers to a number (or code) assigned to the space program. Example: R-001.", "StandardRequiredArea": "The floor area programmed for this space (according to client requirements)." }, - "description": "Set of inverse relationships to space or work interaction requirements (FOR RelatingObject).", + "description": "Architectural program for a space in the building or facility being designed; essentially the requirements definition for such a building space.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcarchitecturedomain/lexical/ifcspaceprogram.htm" }, "IfcSpaceThermalLoadProperties": { @@ -4100,25 +4100,25 @@ "UserDefinedPropertySource": "This attribute must be defined if the PropertySource is USERDEFINED.", "UserDefinedThermalLoadSource": "This attribute must be defined if the ThermalLoadSource is USERDEFINED." }, - "description": "Defines the type of thermal load (e.g., sensible, latent, radiant, etc.).", + "description": "The space thermal load IfcSpaceThermalLoadProperties defines all thermal losses and gains occurring within a space or zone. Those losses or gains can either be requirements (desired values) or criteria (actual values). The thermal load source attribute defines an enumeration of possible sources of the thermal load. The maximum, minimum, time series and applicable value ratio values are all interpreted according to the source. The maximum and minimum values should not be used if time series values are provided.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgserviceelements/lexical/ifcspacethermalloadproperties.htm" }, "IfcSpaceType": { "attributes": { "PredefinedType": "Predefined types to define the particular type of space. There may be property set definitions available for each predefined type." }, - "description": "Predefined types to define the particular type of space. There may be property set definitions available for each predefined type.", + "description": "The IfcSpaceType defines a list of commonly shared property set definitions of a space and an optional set of product representations. It is used to define an space specification (i.e. the specific space information, that is common to all occurrences of that space type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcspacetype.htm" }, "IfcSpatialStructureElement": { "attributes": { "CompositionType": "Denotes, whether the predefined spatial structure element represents itself, or an aggregate (complex) or a part (part). The interpretation is given separately for each subtype of spatial structure element.", - "ContainsElements": "Set of spatial containment relationships, that holds those elements, which are contained within this element of the project spatial structure. > NOTE  The spatial containment relationship, established by IfcRelContainedInSpatialStructure, is required to be an hierarchical relationship, i.e. each element can only be assigned to 0 or 1 spatial structure element. ", + "ContainsElements": "Set of spatial containment relationships, that holds those elements, which are contained within this element of the project spatial structure. > NOTE The spatial containment relationship, established by IfcRelContainedInSpatialStructure, is required to be an hierarchical relationship, i.e. each element can only be assigned to 0 or 1 spatial structure element.", "LongName": "Long name for a spatial structure element, used for informal purposes. Maybe used in conjunction with the inherited Name attribute.", - "ReferencesElements": "Set of spatial reference relationships, that holds those elements, which are referenced, but not contained, within this element of the project spatial structure. > NOTE  The spatial reference relationship, established by IfcRelReferencedInSpatialStructure, is not required to be an hierarchical relationship, i.e. each element can be assigned to 0, 1 or many spatial structure elements.
EXAMPLE  A curtain wall maybe contained in the ground floor, but maybe referenced in all floors, it reaches.

IFC2x Edition 3 CHANGE  The inverse attribute has been added with upward compatibility for file based exchange. ", + "ReferencesElements": "Set of spatial reference relationships, that holds those elements, which are referenced, but not contained, within this element of the project spatial structure. > NOTE The spatial reference relationship, established by IfcRelReferencedInSpatialStructure, is not required to be an hierarchical relationship, i.e. each element can be assigned to 0, 1 or many spatial structure elements. EXAMPLE A curtain wall maybe contained in the ground floor, but maybe referenced in all floors, it reaches.", "ServicedBySystems": "Set of relationships to Systems, that provides a certain service to the Building. The relationship is handled by the objectified relationship IfcRelServicesBuildings." }, - "description": "Set of spatial containment relationships, that holds those elements, which are contained within this element of the project spatial structure. > NOTE  The spatial containment relationship, established by IfcRelContainedInSpatialStructure, is required to be an hierarchical relationship, i.e. each element can only be assigned to 0 or 1 spatial structure element. ", + "description": "A spatial structure element (IfcSpatialStructureElement) is the generalization of all spatial elements that might be used to define a spatial structure. That spatial structure is often used to provide a project structure to organize a building project.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcspatialstructureelement.htm" }, "IfcSpatialStructureElementType": { @@ -4129,21 +4129,21 @@ "attributes": { "Radius": "" }, - "description": "", + "description": "Definition from ISO/CD 10303-42:1992: A sphere is a CSG primitive with a spherical shape defined by a centre and a radius.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsphere.htm" }, "IfcStackTerminalType": { "attributes": { "PredefinedType": "Identifies the predefined types of stack terminal from which the type required may be set." }, - "description": "Identifies the predefined types of stack terminal from which the type required may be set.", + "description": "The IfcStackTerminalType defines a particular type of IfcFlowTerminal placed at the top of a ventilating stack (to prevent ingress by birds, rainwater etc.) or rainwater pipe (to act as a collector or hopper for discharge from guttering).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcplumbingfireprotectiondomain/lexical/ifcstackterminaltype.htm" }, "IfcStair": { "attributes": { "ShapeType": "Predefined shape types for a stair that are specified in an Enum." }, - "description": "Predefined shape types for a stair that are specified in an Enum.", + "description": "Definition from ISO 6707-1:1989: Construction comprising a succession of horizontal stages (steps or landings) that make it possible to pass on foot to other levels.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcstair.htm" }, "IfcStairFlight": { @@ -4153,14 +4153,14 @@ "RiserHeight": "Vertical distance from tread to tread. The riser height is supposed to be equal for all stairs in a stair flight.", "TreadLength": "Horizontal distance from the front to the back of the tread. The tread length is supposed to be equal for all steps of the stair flight." }, - "description": "Horizontal distance from the front to the back of the tread. The tread length is supposed to be equal for all steps of the stair flight.", + "description": "Assembly of building components in a single \"run\" of stair steps (not interrupted by a landing). The stair steps and any stringers are included in this object. A winder is regarded as part of a stair flight.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcstairflight.htm" }, "IfcStairFlightType": { "attributes": { "PredefinedType": "Identifies the predefined types of a stair flight element from which the type required may be set." }, - "description": "Identifies the predefined types of a stair flight element from which the type required may be set.", + "description": "The element type (IfcStairFlightType) defines a list of commonly shared property set definitions of a stair flight and an optional set of product representations. It is used to define an stair flight specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcstairflighttype.htm" }, "IfcStructuralAction": { @@ -4168,7 +4168,7 @@ "CausedBy": "Optional reference to an instance of IfcStructuralReaction representing a result of another structural analysis model which creates this action upon the considered structural analysis model.", "DestabilizingLoad": "Indicates if this action may cause a stability problem. If it is 'FALSE', no further investigations regarding stability problems are necessary." }, - "description": "Optional reference to an instance of IfcStructuralReaction representing a result of another structural analysis model which creates this action upon the considered structural analysis model.", + "description": "A structural action is a structural activity that acts upon a structural item or building element.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralaction.htm" }, "IfcStructuralActivity": { @@ -4177,7 +4177,7 @@ "AssignedToStructuralItem": "References to the IfcRelConnectsStructuralActivity relationship by which activities can be associated to structural representations.", "GlobalOrLocal": "Indicates if the load values are defined by using the local coordinate system or the global project coordinate system." }, - "description": "References to the IfcRelConnectsStructuralActivity relationship by which activities can be associated to structural representations.", + "description": "The abstract entity IfcStructuralActivity combines the definition of actions (such as forces, displacement, etc) and reactions (supports and deformations) which are specified by using the basic load definitions from the_IfcStructuralLoadResource_. It also uses the inherited capabilities for the definition of a location and a local coordinate system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralactivity.htm" }, "IfcStructuralAnalysisModel": { @@ -4187,7 +4187,7 @@ "OrientationOf2DPlane": "If the selected model type (PredefinedType) describes a 2D system the orientation is needed to define the upright direction to the focused plane (z-axes). This is needed because all data for the structural analysis model (structural members, structural activities) are defined by using 3-D space. The orientation is given in relation to the coordinate system of the project. By 3D systems this value is not asserted.", "PredefinedType": "Defines the type of the structural analysis model." }, - "description": "References to all result groups available for this structural analysis model.", + "description": "The IfcStructuralAnalysisModel is used to assemble all information needed to represent a structural analysis model. It encompasses certain general properties (such as analysis type), references to all contained structural members, structural supports or connecting members, the connection properties, as well as loads and the respective load results.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralanalysismodel.htm" }, "IfcStructuralConnection": { @@ -4195,14 +4195,14 @@ "AppliedCondition": "Optional reference to an instance of IfcBoundaryCondition which defines the support condition of this 'connection'.", "ConnectsStructuralMembers": "References to the IfcRelConnectsStructuralMembers relationship by which structural members can be associated to structural connections." }, - "description": "References to the IfcRelConnectsStructuralMembers relationship by which structural members can be associated to structural connections.", + "description": "The abstract entity IfcStructuralConnection is the superclass of entities representing structural supports or connecting elements (nodes). Point connections, curve connections and surface connections are supported.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralconnection.htm" }, "IfcStructuralConnectionCondition": { "attributes": { "Name": "Optionally defines a name for this connection condition." }, - "description": "Optionally defines a name for this connection condition.", + "description": "Instances of the entity IfcStructuralConnectionCondition or its respective subclasses shall be used to describe more rarely needed connection properties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralconnectioncondition.htm" }, "IfcStructuralCurveConnection": { @@ -4213,7 +4213,7 @@ "attributes": { "PredefinedType": "Defines the load carrying behavior of the member, as far as it is taken into account in the analysis." }, - "description": "Defines the load carrying behavior of the member, as far as it is taken into account in the analysis.", + "description": "Definition from IAI: Instances of the entity IfcStructuralCurveMember shall be used to describe linear structural elements. Profile and material properties are defined by using objectified relationships:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralcurvemember.htm" }, "IfcStructuralCurveMemberVarying": { @@ -4224,14 +4224,14 @@ "attributes": { "AssignedStructuralActivity": "Inverse relationship to all structural activities (i.e. to actions or reactions) which are assigned to this structural member." }, - "description": "Inverse relationship to all structural activities (i.e. to actions or reactions) which are assigned to this structural member.", + "description": "**Definition", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralitem.htm" }, "IfcStructuralLinearAction": { "attributes": { "ProjectedOrTrue": "Defines if the load values are given by using the length of the member on which they act (true length) or by using the projected length resulting from the loaded member and the global project coordinate system. It is only considered if the global project coordinate system is used, and if the action is of type IfcStructuralLinearAction or IfcStructuralPlanarAction." }, - "description": "Defines if the load values are given by using the length of the member on which they act (true length) or by using the projected length resulting from the loaded member and the global project coordinate system. It is only considered if the global project coordinate system is used, and if the action is of type IfcStructuralLinearAction or IfcStructuralPlanarAction.", + "description": "Instances of the entity IfcStructuralLinearAction are used to define constant linear actions. Structural loads applicable to linear actions are IfcStructuralLoadLinearForce and IfcStructuralLoadTemperature.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructurallinearaction.htm" }, "IfcStructuralLinearActionVarying": { @@ -4240,14 +4240,14 @@ "VaryingAppliedLoadLocation": "A shape aspect, containing a list of shape representations, each defining either one Cartesian point or one point on curve (by parameter values) which are needed to provide the positions of the VaryingAppliedLoads. The values contained in the list of IfcShapeAspect.ShapeRepresentations correspond to the values at the same position in the list VaryingAppliedLoads.", "VaryingAppliedLoads": "Derived list of all varying applied loads by pushing the inherited AppliedLoad value to the beginning of the list of SubsequentAppliedLoads. IfcAddToBeginOfList(SELF\\IfcStructuralActivity.AppliedLoad, SubsequentAppliedLoads)" }, - "description": "Derived list of all varying applied loads by pushing the inherited AppliedLoad value to the beginning of the list of SubsequentAppliedLoads. IfcAddToBeginOfList(SELF\\IfcStructuralActivity.AppliedLoad, SubsequentAppliedLoads)", + "description": "Instances of the entity IfcStructuralLinearActionVarying are used to define varying linear actions. IfcStructuralLinearActionVarying inherits the needed attributes and applicable structural load types from its superclass IfcStructuralLinearAction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructurallinearactionvarying.htm" }, "IfcStructuralLoad": { "attributes": { "Name": "Optionally defines a name for this load." }, - "description": "Optionally defines a name for this load.", + "description": "The abstract entity IfcStructuralLoad is the supertype of all loads which can be defined (actions or reactions, as well as dynamic or static).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralload.htm" }, "IfcStructuralLoadGroup": { @@ -4260,7 +4260,7 @@ "Purpose": "Description of the purpose of this instance. Among else, possible values of the Purpose of load combinations are 'SLS', 'ULS', 'ALS' to indicate serviceability, ultimate, or accidental limit state.", "SourceOfResultGroup": "Results which were computed using this load group." }, - "description": "Analysis models in which this load group is used.", + "description": "The entity IfcStructuralLoadGroup is used to structure the physical impacts. By using the grouping features inherited from IfcGroup, instances of IfcStructuralAction (or its subclasses) and of IfcStructuralLoadGroup can be used to define load groups, load cases and load combinations. An optional coefficient can be provided to represent safety factors known from several codes of practice. (see also IfcLoadGroupTypeEnum)", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralloadgroup.htm" }, "IfcStructuralLoadLinearForce": { @@ -4272,7 +4272,7 @@ "LinearMomentY": "Linear moment about the y-axis.", "LinearMomentZ": "Linear moment about the z-axis." }, - "description": "Linear moment about the z-axis.", + "description": "An instance of the entity IfcStructuralLoadLinearForce shall be used to define actions on curves.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadlinearforce.htm" }, "IfcStructuralLoadPlanarForce": { @@ -4281,7 +4281,7 @@ "PlanarForceY": "Planar force value in y-direction.", "PlanarForceZ": "Planar force value in z-direction." }, - "description": "Planar force value in z-direction.", + "description": "An instance of the entity IfcStructuralLoadPlanarForce shall be used to define actions on faces.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadplanarforce.htm" }, "IfcStructuralLoadSingleDisplacement": { @@ -4293,14 +4293,14 @@ "RotationalDisplacementRY": "Rotation about the y-axis.", "RotationalDisplacementRZ": "Rotation about the z-axis." }, - "description": "Rotation about the z-axis.", + "description": "Instances of the entity IfcStructuralLoadSingleDisplacement shall be used to define the displacements of an action operating on a single point.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadsingledisplacement.htm" }, "IfcStructuralLoadSingleDisplacementDistortion": { "attributes": { "Distortion": "The distortion curvature given to the displacement load." }, - "description": "The distortion curvature given to the displacement load.", + "description": "Instances of the entity IfcStructuralLoadSingleForceWarping, as a subtype of IfcStructuralLoadSingleForce, shall be used to define an action operation on a single point. In addition to forces and moments defined by its supertype a warping moment can be defined.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadsingledisplacementdistortion.htm" }, "IfcStructuralLoadSingleForce": { @@ -4312,14 +4312,14 @@ "MomentY": "Moment about the y-axis.", "MomentZ": "Moment about the z-axis." }, - "description": "Moment about the z-axis.", + "description": "Instances of the entity IfcStructuralLoadSingleForce shall be used to define the forces and moments of an action operating on a single point.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadsingleforce.htm" }, "IfcStructuralLoadSingleForceWarping": { "attributes": { "WarpingMoment": "The warping moment at the point load." }, - "description": "The warping moment at the point load.", + "description": "Instances of the entity IfcStructuralLoadSingleForceWarping, as a subtype of IfcStructuralLoadSingleForce, shall be used to define an action operation on a single point. In addition to forces and moments defined by its supertype a warping moment can be defined.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadsingleforcewarping.htm" }, "IfcStructuralLoadStatic": { @@ -4332,7 +4332,7 @@ "DeltaT_Y": "Temperature change which is applied to the outer fiber of the positive Y-direction. A positive value describes an increase in temperature.", "DeltaT_Z": "Temperature change which is applied to the outer fiber of the positive Z-direction. A positive value describes an increase in temperature." }, - "description": "Temperature change which is applied to the outer fiber of the positive Z-direction. A positive value describes an increase in temperature.", + "description": "An instance of the entity IfcStructuralLoadTemperature shall be used to define actions which are caused by a temperature change. The change of temperature is given with a constant value which is applied to the complete section and values for the outer fibre of the positive Y and Z directions.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralloadresource/lexical/ifcstructuralloadtemperature.htm" }, "IfcStructuralMember": { @@ -4340,14 +4340,14 @@ "ConnectedBy": "Inverse relationship to all structural connections (i.e. to supports or connecting elements) which are defined for this structural member.", "ReferencesElement": "Inverse link to the relationship object, that connects a physical element to this structural member (the element of which this structural member is the analytical idealization)." }, - "description": "Inverse relationship to all structural connections (i.e. to supports or connecting elements) which are defined for this structural member.", + "description": "Definition from IAI: The abstract entity IfcStructuralMember is the superclass of all structural elements representing the structural behavior of building elements. A further differentiation is made for structural curve members and structural face members (see IfcStructuralCurveMember and IfcStructuralFaceMember). Structural members can have ", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralmember.htm" }, "IfcStructuralPlanarAction": { "attributes": { "ProjectedOrTrue": "Defines if the load values are given by using the length of the member on which they act (true length) or by using the projected length resulting from the loaded member and the global project coordinate system. It is only considered if the global project coordinate system is used, and if the action is of type IfcStructuralLinearAction or IfcStructuralPlanarAction." }, - "description": "Defines if the load values are given by using the length of the member on which they act (true length) or by using the projected length resulting from the loaded member and the global project coordinate system. It is only considered if the global project coordinate system is used, and if the action is of type IfcStructuralLinearAction or IfcStructuralPlanarAction.", + "description": "Instances of the entity IfcStructuralPlanarAction are used to define constant planar actions. Structural loads applicable to planar actions are IfcStructuralLoadPlanarForce and IfcStructuralLoadTemperature.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralplanaraction.htm" }, "IfcStructuralPlanarActionVarying": { @@ -4356,7 +4356,7 @@ "VaryingAppliedLoadLocation": "A shape aspect, containing a list of shape representations, each defining either one Cartesian point or one point on curve (by parameter values) which are needed to provide the positions of the VaryingAppliedLoads. The values contained in the list of IfcShapeAspect.ShapeRepresentations correspond to the values at the same position in the list VaryingAppliedLoads.", "VaryingAppliedLoads": "Derived list of all varying applied loads by pushing the inherited AppliedLoad value to the beginning of the list of SubsequentAppliedLoads. IfcAddToBeginOfList(SELF\\IfcStructuralActivity.AppliedLoad, SubsequentAppliedLoads)" }, - "description": "Derived list of all varying applied loads by pushing the inherited AppliedLoad value to the beginning of the list of SubsequentAppliedLoads. IfcAddToBeginOfList(SELF\\IfcStructuralActivity.AppliedLoad, SubsequentAppliedLoads)", + "description": "Instances of the entity IfcStructuralPlanarActionVarying are used to define varying planar actions. IfcStructuralPlanarActionVarying inherits the needed attributes and applicable structural load types from its superclass IfcStructuralLinearAction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralplanaractionvarying.htm" }, "IfcStructuralPointAction": { @@ -4373,8 +4373,8 @@ }, "IfcStructuralProfileProperties": { "attributes": { - "CentreOfGravityInX": "Location of the profile's centre of gravity in the geometric X direction. The _CentreOfGravityInX_ is measured in the global length unit as defined at _IfcProject.UnitsInContext_. > IFC2x Edition 3 CHANGE  The attribute CentreOfGravityInX is a new attribute. ", - "CentreOfGravityInY": "Location of the profile's centre of gravity in the geometric Y direction. The _CentreOfGravityInY_ is measured in the global length unit as defined at _IfcProject.UnitsInContext_. > IFC2x Edition 3 CHANGE  The attribute CentreOfGravityInY is a new attribute. ", + "CentreOfGravityInX": "Location of the profile's centre of gravity in the geometric X direction. The _CentreOfGravityInX_ is measured in the global length unit as defined at _IfcProject.UnitsInContext_.", + "CentreOfGravityInY": "Location of the profile's centre of gravity in the geometric Y direction. The _CentreOfGravityInY_ is measured in the global length unit as defined at _IfcProject.UnitsInContext_.", "MaximumSectionModulusY": "Bending resistance about Y-axis of profile coordinate system at maximum Z-ordinate. Usually measured in [mm3].", "MaximumSectionModulusZ": "Bending resistance about Z-axis of profile coordinate system at maximum Y-ordinate. Usually measured in [mm3].", "MinimumSectionModulusY": "Bending resistance about Y-axis of profile coordinate system at minimum Z-ordinate. Usually measured in [mm3].", @@ -4390,14 +4390,14 @@ "TorsionalSectionModulus": "Torsional resistance (about the profiles X-axis). Usually measured in [mm3].", "WarpingConstant": "Warping constant of the profile for torsional action. Usually measured in [mm6]." }, - "description": "Location of the profile's centre of gravity in the geometric Y direction. The _CentreOfGravityInY_ is measured in the global length unit as defined at _IfcProject.UnitsInContext_. > IFC2x Edition 3 CHANGE  The attribute CentreOfGravityInY is a new attribute. ", + "description": "Definition from IAI: This is a collection of structural properties applicable to all linear structural members having a profile definition. For the structural profile properties a further material dependent specialization is given for taking into account specific profile properties applicable only in the context of a specific building material.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcstructuralprofileproperties.htm" }, "IfcStructuralReaction": { "attributes": { "Causes": "Optional reference to instances of IfcStructuralAction which directly depend on this reaction. This reference is only needed if dependencies between structural analysis models must be captured." }, - "description": "Optional reference to instances of IfcStructuralAction which directly depend on this reaction. This reference is only needed if dependencies between structural analysis models must be captured.", + "description": "A structural reaction is a structural activity that results from a structural action imposed to a structural item or building element. A support is an example for a structural reaction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralreaction.htm" }, "IfcStructuralResultGroup": { @@ -4407,7 +4407,7 @@ "ResultGroupFor": "Reference to an instance of IfcStructuralAnalysisModel for which this instance captures a result.", "TheoryType": "Specifies the analysis theory used to obtain the respective results." }, - "description": "Reference to an instance of IfcStructuralAnalysisModel for which this instance captures a result.", + "description": "Instances of the entity IfcStructuralResultGroup are used to group results of structural analysis calculations and to capture the connection to the underlying basic load group. The basic functionality for grouping inherited from IfcGroup is used to collect instances from IfcStructuralReaction or its respective subclasses.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralresultgroup.htm" }, "IfcStructuralSteelProfileProperties": { @@ -4417,7 +4417,7 @@ "ShearAreaY": "Area of the profile for calculating the shear stress for a shear force parallel to the profile's Y-axis. Usually measured in [mm2].", "ShearAreaZ": "Area of the profile for calculating the shear stress for a shear force parallel to the profile's Z-axis. Usually measured in [mm2]." }, - "description": "Ratio of plastic versus elastic bending moment capacity (about z-axis) of the profile.", + "description": "This is a collection of structural properties applicable to all linear structural members having a profile definition. These structural members are made of steel (or other metalic and isotropic material).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofilepropertyresource/lexical/ifcstructuralsteelprofileproperties.htm" }, "IfcStructuralSurfaceConnection": { @@ -4429,7 +4429,7 @@ "PredefinedType": "Defines the load carrying behavior of the member, as far as it is taken into account in the analysis.", "Thickness": "Defines the typically understood thickness of the structural face member, i.e. the smallest spatial dimension of the element." }, - "description": "Defines the typically understood thickness of the structural face member, i.e. the smallest spatial dimension of the element.", + "description": "Instances of the entity IfcStructuralSurfaceMember shall be used to describe planar structural elements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfacemember.htm" }, "IfcStructuralSurfaceMemberVarying": { @@ -4438,7 +4438,7 @@ "VaryingThickness": "Derived list of all varying thickness values by pushing the inherited starting thickness to the beginning of the list of SubsequentThickness. IfcAddToBeginOfList(SELF\\IfcStructuralSurfaceMember.Thickness, SubsequentThickness)", "VaryingThicknessLocation": "A shape aspect, containing a list of shape representations, each defining either one Cartesian point or one point on surface (by parameter values) which are needed to provide the positions of the VaryingThickness. The values contained in the list of IfcShapeAspect.ShapeRepresentations correspond to the values at the same position in the list VaryingThickness. The locations shall be along the outer bounds of the face (or surface) only." }, - "description": "Derived list of all varying thickness values by pushing the inherited starting thickness to the beginning of the list of SubsequentThickness. IfcAddToBeginOfList(SELF\\IfcStructuralSurfaceMember.Thickness, SubsequentThickness)", + "description": "Instances of the entity IfcStructuralSurfaceMemberVarying shall be used to describe planar structural elements with a varying thickness.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfacemembervarying.htm" }, "IfcStructuredDimensionCallout": { @@ -4451,11 +4451,11 @@ }, "IfcStyledItem": { "attributes": { - "Item": "A geometric representation item to which the style is assigned. > IFC2x Edition 2 Addendum 2 CHANGE The attribute Item has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "Item": "A geometric representation item to which the style is assigned.", "Name": "The word, or group of words, by which the styled item is referred to.", "Styles": "Representation style assignments which are assigned to an item. NOTE: In current IFC release only one presentation style assignment shall be assigned." }, - "description": "The word, or group of words, by which the styled item is referred to.", + "description": "Definition from ISO/CD 10303-46:1992: The styled item is an assignment of style for presentation to a geometric representation item as it is used in a representation.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcstyleditem.htm" }, "IfcStyledRepresentation": { @@ -4467,14 +4467,14 @@ "JobDescription": "The description of the jobs that this subcontract should complete.", "SubContractor": "The actor performing the role of the subcontracted resource." }, - "description": "The description of the jobs that this subcontract should complete.", + "description": "An IfcSubContractResource is a construction resource needed in a construction process that represents a type of sub-contractor.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcconstructionmgmtdomain/lexical/ifcsubcontractresource.htm" }, "IfcSubedge": { "attributes": { "ParentEdge": "The Edge, or Subedge, which contains the Subedge." }, - "description": "The Edge, or Subedge, which contains the Subedge.", + "description": "Definition from ISO/DIS 10303-42:1999(E): A subedge is an edge whose domain is a connected portion of the domain of an existing edge. The topological constraints on a subedge are the same as those on an edge.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcsubedge.htm" }, "IfcSurface": { @@ -4488,7 +4488,7 @@ "ReferenceSurface": "The surface containing the Directrix.", "StartParam": "The parameter value on the Directrix at which the sweeping operation commences." }, - "description": "The surface containing the Directrix.", + "description": "Definition from ISO/DIS 10303-42:1999(E): A surface curve swept area solid is a type of swept area solid which is the result of sweeping a face along a Directrix lying on a ReferenceSurface. The orientation of the SweptArea is related to the direction of the surface normal.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsurfacecurvesweptareasolid.htm" }, "IfcSurfaceOfLinearExtrusion": { @@ -4497,7 +4497,7 @@ "ExtrudedDirection": "The direction of the extrusion.", "ExtrusionAxis": "The extrusion axis defined as vector. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector (ExtrudedDirection, Depth)" }, - "description": "The extrusion axis defined as vector. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector (ExtrudedDirection, Depth)", + "description": "Definition from ISO/CD 10303-42:1992: This surface is a simple swept surface or a generalized cylinder obtained by sweeping a curve in a given direction. The parameterization is as follows where the curve has a parameterization l(u):", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcsurfaceoflinearextrusion.htm" }, "IfcSurfaceOfRevolution": { @@ -4505,7 +4505,7 @@ "AxisLine": "The line coinciding with the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(AxisPosition.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(AxisPosition.Z,1.0))", "AxisPosition": "A point on the axis of revolution and the direction of the axis of revolution." }, - "description": "The line coinciding with the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(AxisPosition.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(AxisPosition.Z,1.0))", + "description": "Definition from ISO/CD 10303-42:1992: A surface of revolution (IfcSurfaceOfRevolution) is the surface obtained by rotating a curve one complete revolution about an axis. The data shall be interpreted as below.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcsurfaceofrevolution.htm" }, "IfcSurfaceStyle": { @@ -4513,17 +4513,17 @@ "Side": "An indication of which side of the surface to apply the style.", "Styles": "A collection of different surface styles." }, - "description": "A collection of different surface styles.", + "description": "An assignment of one or many surface style elements to a surface, defined by subtypes of IfcSurface, IfcFaceBasedSurfaceModel, IfcShellBasedSurfaceModel, or by subtypes of IfcSolidModel. The positive direction of the surface normal relates to the positive side. In case of solids the outside of the solid is to be taken as positive side.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestyle.htm" }, "IfcSurfaceStyleLighting": { "attributes": { - "DiffuseReflectionColour": "The degree of diffusion of the reflected light. In the case of specular surfaces there is no diffusion. The greater the diffusing power of the reflecting surface, the smaller the specular component of the reflected light, up to the point where only diffuse light is produced. A value of 1 means totally diffuse for that colour part of the light. > The factor can be measured physically and has three ratios for the red, green and blue part of the light. ", - "DiffuseTransmissionColour": "The degree of diffusion of the transmitted light. In the case of completely transparent materials there is no diffusion. The greater the diffusing power, the smaller the direct component of the transmitted light, up to the point where only diffuse light is produced.A value of 1 means totally diffuse for that colour part of the light. > The factor can be measured physically and has three ratios for the red, green and blue part of the light. ", - "ReflectanceColour": "A coefficient that determines the extent that the light falling onto a surface is fully or partially reflected. > The factor can be measured physically and has three ratios for the red, green and blue part of the light. ", - "TransmissionColour": "Describes how the light falling on a body is totally or partially transmitted. > The factor can be measured physically and has three ratios for the red, green and blue part of the light. " + "DiffuseReflectionColour": "The degree of diffusion of the reflected light. In the case of specular surfaces there is no diffusion. The greater the diffusing power of the reflecting surface, the smaller the specular component of the reflected light, up to the point where only diffuse light is produced. A value of 1 means totally diffuse for that colour part of the light. > The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "DiffuseTransmissionColour": "The degree of diffusion of the transmitted light. In the case of completely transparent materials there is no diffusion. The greater the diffusing power, the smaller the direct component of the transmitted light, up to the point where only diffuse light is produced.A value of 1 means totally diffuse for that colour part of the light. > The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "ReflectanceColour": "A coefficient that determines the extent that the light falling onto a surface is fully or partially reflected. > The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "TransmissionColour": "Describes how the light falling on a body is totally or partially transmitted. > The factor can be measured physically and has three ratios for the red, green and blue part of the light." }, - "description": "A coefficient that determines the extent that the light falling onto a surface is fully or partially reflected. > The factor can be measured physically and has three ratios for the red, green and blue part of the light. ", + "description": "IfcSurfaceStyleLighting is a container class for properties for calculation of physically exact illuminance related to a particular surface style.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestylelighting.htm" }, "IfcSurfaceStyleRefraction": { @@ -4531,7 +4531,7 @@ "DispersionFactor": "The Abbe constant given as a fixed ratio between the refractive indices of the material at different wavelengths. A low Abbe number means a high dispersive power. In general this translates to a greater angular spread of the emergent spectrum.", "RefractionIndex": "The index of refraction for all wave lengths of light. The refraction index is the ratio between the speed of light in a vacuum and the speed of light in the medium. E.g. glass has a refraction index of 1.5, whereas water has an index of 1.33" }, - "description": "The Abbe constant given as a fixed ratio between the refractive indices of the material at different wavelengths. A low Abbe number means a high dispersive power. In general this translates to a greater angular spread of the emergent spectrum.", + "description": "IfcSurfaceStyleRefraction extends the surface style lighting, or the surface style rendering definition for properties for calculation of physically exact illuminance by adding seldomly used properties. Currently this includes the refraction index (by which the light ray refracts when passing through a prism) and the dispersion factor (or Abbe constant) which takes into account the wavelength dependency of the refraction.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestylerefraction.htm" }, "IfcSurfaceStyleRendering": { @@ -4545,21 +4545,21 @@ "TransmissionColour": "The transmissive part of the reflectance equation can be given as either a colour or a scalar factor. It only applies to materials which Transparency field is greater than zero. The transmissive colour field specifies the colour that passes through a transparant material (like the colour that shines through a glass). The transmissive factor defines the transmissive part, the transmissive colour is then defined by surface colour \\* transmissive factor.", "Transparency": "Definition from ISO/CD 10303-46: The degree of transparency is indicated by the percentage of light traversing the surface. Definition from VRML97 - ISO/IEC 14772-1:1997: The transparency field specifies how \"clear\" an object is, with 1.0 being completely transparent, and 0.0 completely opaque. If not given, the value 0.0 (opaque) is assumed." }, - "description": "Identifies the predefined types of reflectance method from which the method required may be set.", + "description": "IfcSurfaceStyleRendering holds the properties for visualization related to a particular surface side style.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestylerendering.htm" }, "IfcSurfaceStyleShading": { "attributes": { "SurfaceColour": "The colour used to render the surface. The surface colour for visualisation is defined by specifying the intensity of red, green and blue." }, - "description": "The colour used to render the surface. The surface colour for visualisation is defined by specifying the intensity of red, green and blue.", + "description": "Definition from ISO/CD 10303-46:1992: The surface style rendering allows the realistic visualization of surfaces referring to rendering techniques based on the laws of physics and mathematics.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestyleshading.htm" }, "IfcSurfaceStyleWithTextures": { "attributes": { "Textures": "The textures applied to the surface. Only one image map with the same image map type shall be applied." }, - "description": "The textures applied to the surface. Only one image map with the same image map type shall be applied.", + "description": "Definition from IAI: The entity IfcSurfaceStyleWithTextures allows for the assignment of image textures to surface styles. These image textures can be applied repeating across the surface or mapped with a particular scale upon the surface.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacestylewithtextures.htm" }, "IfcSurfaceTexture": { @@ -4569,7 +4569,7 @@ "TextureTransform": "These parameters support changes to the size, orientation, and position of textures on shapes. Note that these operations appear reversed when viewed on the surface of geometry. For example, a scale value of (2 2) will scale the texture coordinates and have the net effect of shrinking the texture size by a factor of 2 (texture coordinates are twice as large and thus cause the texture to repeat). A translation of (0.5 0.0) translates the texture coordinates +.5 units along the S-axis and has the net effect of translating the texture -0.5 along the S-axis on the geometry's surface. A rotation of PI/2 of the texture coordinates results in a -PI/2 rotation of the texture on the geometry.", "TextureType": "Identifies the predefined types of image map from which the type required may be set." }, - "description": "These parameters support changes to the size, orientation, and position of textures on shapes. Note that these operations appear reversed when viewed on the surface of geometry. For example, a scale value of (2 2) will scale the texture coordinates and have the net effect of shrinking the texture size by a factor of 2 (texture coordinates are twice as large and thus cause the texture to repeat). A translation of (0.5 0.0) translates the texture coordinates +.5 units along the S-axis and has the net effect of translating the texture -0.5 along the S-axis on the geometry's surface. A rotation of PI/2 of the texture coordinates results in a -PI/2 rotation of the texture on the geometry.", + "description": "Definition from IAI: An IfcSurfaceTexture provides a 2-dimensional image-based texture map. It can either be given by referencing an external image file through an URL reference (IfcImageTexture), or by explicitly including an array of pixels (IfcPixelTexture).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsurfacetexture.htm" }, "IfcSweptAreaSolid": { @@ -4577,7 +4577,7 @@ "Position": "Position coordinate system for the swept area.", "SweptArea": "The surface defining the area to be swept. It is given as a profile definition within the xy plane of the position coordinate system." }, - "description": "Position coordinate system for the swept area.", + "description": "Definition from ISO/CD 10303-42:1992: The swept area solid entity collects the entities which are defined procedurally by sweeping action on planar bounded surfaces. The position is space of the swept solid will be dependent upon the position of the swept area. The swept area will be a face of the resulting swept area solid, except for the case of a revolved area solid with angle equal to 2 p (or 360 degrees).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsweptareasolid.htm" }, "IfcSweptDiskSolid": { @@ -4588,7 +4588,7 @@ "Radius": "The radius of the circular disk to be swept along the directrix.", "StartParam": "The parameter value on the directrix at which the sweeping operation commences." }, - "description": "The parameter value on the directrix at which the sweeping operation ends.", + "description": "Definition from ISO/FDIS 10303-42-ed3:2002: A swept disk solid is the solid produced by sweeping a circular disk along a three dimensional curve. During the sweeping operation the normal to the plane of the circular disk is in the direction of the tangent to the directrix curve and the center of the disk lies on the directrix. The circular disk may, optionally, have a central hole, in this case the resulting solid has a through hole, or, an internal void when the directrix forms a close curve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricmodelresource/lexical/ifcsweptdisksolid.htm" }, "IfcSweptSurface": { @@ -4597,28 +4597,28 @@ "Position": "Position coordinate system for the placement of the profile within the xy plane of the axis placement.", "SweptCurve": "The curve to be swept in defining the surface. The curve is defined as a profile within the position coordinate system." }, - "description": "The space dimensionality of this class, derived from the dimensionality of the Position. Position.Dim", + "description": "Definition from ISO/CD 10303-42:1992: A swept surface is one that is constructed by sweeping a curve along another curve.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcsweptsurface.htm" }, "IfcSwitchingDeviceType": { "attributes": { "PredefinedType": "Identifies the predefined types of switch from which the type required may be set." }, - "description": "Identifies the predefined types of switch from which the type required may be set.", + "description": "An IfcSwitchingDeviceType defines a particular type of switch which is a mechanically operated contactor.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifcswitchingdevicetype.htm" }, "IfcSymbolStyle": { "attributes": { "StyleOfSymbol": "The style applied to the symbol for its visual appearance." }, - "description": "The style applied to the symbol for its visual appearance.", + "description": "Definition from ISO/CD 10303-46:1992: The symbol style is the presentation style that indicates the presentation of annotation symbols.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifcsymbolstyle.htm" }, "IfcSystem": { "attributes": { "ServicesBuildings": "Reference to the ~~building~~ spatial structure via the objectified relationship _IfcRelServicesBuildings_, which is serviced by the system." }, - "description": "Reference to the ~~building~~ spatial structure via the objectified relationship _IfcRelServicesBuildings_, which is serviced by the system.", + "description": "Organized combination of related parts within an AEC product, composed for a common purpose or function or to provide a service. System is essentially a functionally related aggregation of products. The grouping relationship to one or several instances of IfcProduct (the system members) is handled by IfcRelAssignsToGroup.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifcsystem.htm" }, "IfcSystemFurnitureElementType": { @@ -4627,7 +4627,7 @@ }, "IfcTShapeProfileDef": { "attributes": { - "CentreOfGravityInY": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInY": "Location of centre of gravity along the x axis measured from the center of the bounding box.", "Depth": "Web lengths, see illustration above (= h).", "FilletRadius": "Fillet radius according the above illustration (= r1). If it is not given, zero is assumed.", "FlangeEdgeRadius": "Edge radius according the above illustration (= r2). If it is not given, zero is assumed.", @@ -4638,7 +4638,7 @@ "WebSlope": "Slope of flange of the profile. If it is not given, zero is assumed.", "WebThickness": "Constant wall thickness of web (= ts)." }, - "description": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "Definition from IAI: The IfcTShapeProfileDef defines a section profile that provides the defining parameters of a T-shaped section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifctshapeprofiledef.htm" }, "IfcTable": { @@ -4649,7 +4649,7 @@ "NumberOfHeadings": "The number of headings in a table. This is restricted by WR3 to max. one. SIZEOF(QUERY( Temp <* Rows | Temp.IsHeading))", "Rows": "Reference to information content of rows." }, - "description": "The number of rows in a table that contains data, i.e. total number of rows minus number of heading rows in table. SIZEOF(QUERY( Temp <* Rows | NOT(Temp.IsHeading)))", + "description": "A data structure for the provision of information in the form of rows and columns. Each instance may have a heading row with titles or descriptions for each column. The rows of information are stored as a list of IfcTableRow objects.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcutilityresource/lexical/ifctable.htm" }, "IfcTableRow": { @@ -4658,14 +4658,14 @@ "OfTable": "Reference to the IfcTable, in which the IfcTableRow is defined (or contained).", "RowCells": "The value of information by row and column using the units defined. NOTE - The row value identifies both the actual value and the units in which it is recorded. Each cell (unique row and column) may have a different value AND different units. If the row is a heading row, then the row values are strings defined by the IfcString." }, - "description": "Reference to the IfcTable, in which the IfcTableRow is defined (or contained).", + "description": "The information content of each row within the table (other than the heading row). A table contains a number of rows which record information concerning the instance of the type of information recorded within the table.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcutilityresource/lexical/ifctablerow.htm" }, "IfcTankType": { "attributes": { "PredefinedType": "Defines the type of tank." }, - "description": "Defines the type of tank.", + "description": "The element type IfcTankType defines a list of commonly shared property set definitions of a tank and an optional set of product representations. It is used to define a tank specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifctanktype.htm" }, "IfcTask": { @@ -4676,7 +4676,7 @@ "TaskId": "An identifying designation given to a task.", "WorkMethod": "The method of work used in carrying out a task." }, - "description": "A value that indicates the relative priority of the task (in comparison to the priorities of other tasks).", + "description": "An IfcTask is an identifiable unit of work to be carried out independently of any other units of work in a construction project.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprocessextension/lexical/ifctask.htm" }, "IfcTelecomAddress": { @@ -4685,9 +4685,9 @@ "FacsimileNumbers": "The list of fax numbers at which fax messages may be received.", "PagerNumber": "The pager number at which paging messages may be received.", "TelephoneNumbers": "The list of telephone numbers at which telephone messages may be received.", - "WWWHomePageURL": "The world wide web address at which the preliminary page of information for the person or organization can be located. > NOTE: Information on the world wide web for a person or organization may be separated into a number of pages and across a number of host sites, all of which may be linked together. It is assumed that all such information may be referenced from a single page that is termed the home page for that person or organization. " + "WWWHomePageURL": "The world wide web address at which the preliminary page of information for the person or organization can be located. > NOTE: Information on the world wide web for a person or organization may be separated into a number of pages and across a number of host sites, all of which may be linked together. It is assumed that all such information may be referenced from a single page that is termed the home page for that person or organization." }, - "description": "The world wide web address at which the preliminary page of information for the person or organization can be located. > NOTE: Information on the world wide web for a person or organization may be separated into a number of pages and across a number of host sites, all of which may be linked together. It is assumed that all such information may be referenced from a single page that is termed the home page for that person or organization. ", + "description": "Address to which telephone, electronic mail and other forms of telecommunications should be addressed.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcactorresource/lexical/ifctelecomaddress.htm" }, "IfcTendon": { @@ -4701,7 +4701,7 @@ "PredefinedType": "Predefined generic types for a tendon.", "TensionForce": "The maximum allowed tension force that can be applied on the tendon." }, - "description": "The smallest curvature radius calculated on the whole effective length of the tendon where the tension properties are still valid.", + "description": "A steel element such as a wire, cable, bar, rod, or strand used to impart prestress to concrete when the element is tensioned.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcstructuralelementsdomain/lexical/ifctendon.htm" }, "IfcTendonAnchor": { @@ -4712,16 +4712,16 @@ "attributes": { "AnnotatedCurve": "The curve being annotated by the terminator symbol." }, - "description": "The curve being annotated by the terminator symbol.", + "description": "A terminator symbol is a special type of an annotated symbol which is assigned to a curve to indicate a direction, origin, target, or any other associated meaning.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdimensioningresource/lexical/ifcterminatorsymbol.htm" }, "IfcTextLiteral": { "attributes": { "Literal": "The text literal to be presented.", "Path": "The writing direction of the text literal.", - "Placement": "An _IfcAxis2Placement_ that determines the placement and orientation of the presented string. > When used with a text style based on IfcTextStyleWithBoxCharacteristics then the y-axis is taken as the reference direction for the box rotation angle and the box slant angle. " + "Placement": "An _IfcAxis2Placement_ that determines the placement and orientation of the presented string. > When used with a text style based on IfcTextStyleWithBoxCharacteristics then the y-axis is taken as the reference direction for the box rotation angle and the box slant angle." }, - "description": "The writing direction of the text literal.", + "description": "Definition from IAI: The text literal is a geometric representation item which describes a text string using a string literal and additional position, and path information.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctextliteral.htm" }, "IfcTextLiteralWithExtent": { @@ -4729,27 +4729,27 @@ "BoxAlignment": "The alignment of the text literal relative to its position.", "Extent": "The extent in the x and y direction of the text literal." }, - "description": "The alignment of the text literal relative to its position.", + "description": "Definition from IAI: The text literal with extent is a text literal with the additional explicit information of the planar extent (or surrounding text box). An alignment attribute defines, how the text box is aligned to the placement and how it may expand.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctextliteralwithextent.htm" }, "IfcTextStyle": { "attributes": { "TextCharacterAppearance": "A character style to be used for presented text.", - "TextFontStyle": "The style applied to the text font for its visual appearance. It defines the font family, font style, weight and size. > IFC2x Edition 2 Addendum 2 CHANGE The attribute TextFontStyle is a new attribute attached to IfcTextStyle. ", - "TextStyle": "The style applied to the text block for its visual appearance. It defines the text block characteristics, either for vector based or monospace text fonts (see select item _IfcTextStyleWithBoxCharacteristics_), or for true type text fonts (see select item _IfcTextStyleTextModel_. > IFC2x Edition 3 CHANGE  The attribute TextBlockStyle has been changed from SET[1:?] to a non-aggregated optional, it has been renamed from TextStyles. " + "TextFontStyle": "The style applied to the text font for its visual appearance. It defines the font family, font style, weight and size.", + "TextStyle": "The style applied to the text block for its visual appearance. It defines the text block characteristics, either for vector based or monospace text fonts (see select item _IfcTextStyleWithBoxCharacteristics_), or for true type text fonts (see select item _IfcTextStyleTextModel_." }, - "description": "The style applied to the text font for its visual appearance. It defines the font family, font style, weight and size. > IFC2x Edition 2 Addendum 2 CHANGE The attribute TextFontStyle is a new attribute attached to IfcTextStyle. ", + "description": "Definition from ISO/CD 10303-46:1992: The text style is a presentation style for annotation text..", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifctextstyle.htm" }, "IfcTextStyleFontModel": { "attributes": { "FontFamily": "The value is a prioritized list of font family names and/or generic family names. The first list entry has the highest priority, if this font fails, the next list item shall be used. The last list item should (if possible) be a generic family.", - "FontSize": "The font size provides the size or height of the text font. > NOTE  The following values are allowed, <IfcLengthMeasure, with positive values, the length unit is globally defined at IfcUnitAssignment.", + "FontSize": "The font size provides the size or height of the text font. > NOTE The following values are allowed, NOTE  It has been introduced for later compliance to full CSS1 support.", - "FontWeight": "The font weight property selects the weight of the font. > NOTE  Values other then 'normal' and 'bold' have been introduced for later compliance to full CSS1 support." + "FontVariant": "The font variant property selects between normal and small-caps. > NOTE It has been introduced for later compliance to full CSS1 support.", + "FontWeight": "The font weight property selects the weight of the font. > NOTE Values other then 'normal' and 'bold' have been introduced for later compliance to full CSS1 support." }, - "description": "The font size provides the size or height of the text font. > NOTE  The following values are allowed, <IfcLengthMeasure, with positive values, the length unit is globally defined at IfcUnitAssignment.", + "description": "Definition from CSS1 (W3C Recommendation): Setting font properties will be among the most common uses of style sheets. Unfortunately, there exists no well-defined and universally accepted taxonomy for classifying fonts, and terms that apply to one font family may not be appropriate for others. E.g. 'italic' is commonly used to label slanted text, but slanted text may also be labeled as being Oblique, Slanted, Incline, Cursive or Kursiv. Therefore it is not a simple problem to map typical font selection properties to a specific font.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationresource/lexical/ifctextstylefontmodel.htm" }, "IfcTextStyleForDefinedFont": { @@ -4757,20 +4757,20 @@ "BackgroundColour": "This property sets the background color of an element.", "Colour": "This property describes the text color of an element (often referred to as the foreground color)." }, - "description": "This property sets the background color of an element.", + "description": "Definition from ISO/CD 10303-46:1992: A text style for defined font is a character glyph style for pre-defined or externally defined text fonts.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifctextstylefordefinedfont.htm" }, "IfcTextStyleTextModel": { "attributes": { - "LetterSpacing": "The length unit indicates an addition to the default space between characters. Values can be negative, but there may be implementation-specific limits. The user agent is free to select the exact spacing algorithm. The letter spacing may also be influenced by justification (which is a value of the 'align' property). > NOTE  The following values are allowed, IfcDescriptiveMeasure with value='normal', or IfcLengthMeasure, the length unit is globally defined at IfcUnitAssignment.", - "LineHeight": "The property sets the distance between two adjacent lines' baselines. When a ratio value is specified, the line height is given by the font size of the current element multiplied with the numerical value. A value of 'normal' sets the line height to a reasonable value for the element's font. It is suggested that user agents set the 'normal' value to be a ratio number in the range of 1.0 to 1.2. > NOTE  The following values are allowed:
IfcDescriptiveMeasure with value='normal', or
IfcLengthMeasure, with non-negative values, the length unit is globally defined at IfcUnitAssignment, or
IfcRatioMeasure.", + "LetterSpacing": "The length unit indicates an addition to the default space between characters. Values can be negative, but there may be implementation-specific limits. The user agent is free to select the exact spacing algorithm. The letter spacing may also be influenced by justification (which is a value of the 'align' property). > NOTE The following values are allowed, IfcDescriptiveMeasure with value='normal', or IfcLengthMeasure, the length unit is globally defined at IfcUnitAssignment.", + "LineHeight": "The property sets the distance between two adjacent lines' baselines. When a ratio value is specified, the line height is given by the font size of the current element multiplied with the numerical value. A value of 'normal' sets the line height to a reasonable value for the element's font. It is suggested that user agents set the 'normal' value to be a ratio number in the range of 1.0 to 1.2. > NOTE The following values are allowed: IfcDescriptiveMeasure with value='normal', or IfcLengthMeasure, with non-negative values, the length unit is globally defined at IfcUnitAssignment, or IfcRatioMeasure.", "TextAlign": "This property describes how text is aligned horizontally within the element. The actual justification algorithm used is dependent on the rendering algorithm.", "TextDecoration": "This property describes decorations that are added to the text of an element.", - "TextIndent": "The property specifies the indentation that appears before the first formatted line. > NOTE  It has been introduced for later compliance to full CSS1 support.", - "TextTransform": "This property describes how text characters may transform to upper case, lower case, or capitalized case, independent of the character case used in the text literal. > NOTE  It has been introduced for later compliance to full CSS1 support.", - "WordSpacing": "The length unit indicates an addition to the default space between words. Values can be negative, but there may be implementation-specific limits. The user agent is free to select the exact spacing algorithm. The word spacing may also be influenced by justification (which is a value of the 'text-align' property). > NOTE  It has been introduced for later compliance to full CSS1 support." + "TextIndent": "The property specifies the indentation that appears before the first formatted line. > NOTE It has been introduced for later compliance to full CSS1 support.", + "TextTransform": "This property describes how text characters may transform to upper case, lower case, or capitalized case, independent of the character case used in the text literal. > NOTE It has been introduced for later compliance to full CSS1 support.", + "WordSpacing": "The length unit indicates an addition to the default space between words. Values can be negative, but there may be implementation-specific limits. The user agent is free to select the exact spacing algorithm. The word spacing may also be influenced by justification (which is a value of the 'text-align' property). > NOTE It has been introduced for later compliance to full CSS1 support." }, - "description": "The property sets the distance between two adjacent lines' baselines. When a ratio value is specified, the line height is given by the font size of the current element multiplied with the numerical value. A value of 'normal' sets the line height to a reasonable value for the element's font. It is suggested that user agents set the 'normal' value to be a ratio number in the range of 1.0 to 1.2. > NOTE  The following values are allowed:
IfcDescriptiveMeasure with value='normal', or
IfcLengthMeasure, with non-negative values, the length unit is globally defined at IfcUnitAssignment, or
IfcRatioMeasure.", + "description": "Definition from CSS1 (W3C Recommendation): The properties defined in the text model affect the visual presentation of characters, spaces, words, and paragraphs.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifctextstyletextmodel.htm" }, "IfcTextStyleWithBoxCharacteristics": { @@ -4781,14 +4781,14 @@ "BoxWidth": "It is the width scaling factor in the definition of a character glyph.", "CharacterSpacing": "The distance between the character boxes of adjacent characters." }, - "description": "The distance between the character boxes of adjacent characters.", + "description": "Definition from IAI: The text style with box characteristics allows the presentation of annotated text by specifying the characteristics of the character boxes of the text and the spacing between the character boxes.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifctextstylewithboxcharacteristics.htm" }, "IfcTextureCoordinate": { "attributes": { "AnnotatedSurface": "" }, - "description": "", + "description": "Definition from IAI: The IfcTextureCoordinate a an abstract supertype of the different kinds to apply texture coordinates to geometries. For vertex based geometries an explicit assignment of 2D texture vertices to the 3D geometry vertices is supported, in addition there can be a procedural description of texture coordinates. For parametrically described base geometry types a default mapping procedure is given.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctexturecoordinate.htm" }, "IfcTextureCoordinateGenerator": { @@ -4796,21 +4796,21 @@ "Mode": "The mode describes the algorithm used to compute texture coordinates.", "Parameter": "The parameter used by the function as specified by Mode." }, - "description": "The parameter used by the function as specified by Mode.", + "description": "Definition from IAI: The IfcTextureCoordinateGenerator describes a procedurally defined mapping function with input parameter to map 2D texture coordinates to 3D geometry vertices. The allowable Mode values and input Parameter need to be agreed upon in implementer agreements.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctexturecoordinategenerator.htm" }, "IfcTextureMap": { "attributes": { "TextureMaps": "Reference to a list of texture vertex assignment to coordinates within a vertex based geometry." }, - "description": "Reference to a list of texture vertex assignment to coordinates within a vertex based geometry.", + "description": "Definition from IAI: An IfcTextureMap provides the mapping of the 2-dimensional texture coordinates to the surface onto which it is mapped. It is used for mapping the texture to vertex based geometry models, such as", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctexturemap.htm" }, "IfcTextureVertex": { "attributes": { "Coordinates": "The first coordinate[1] is the S, the second coordinate[2] is the T parameter value." }, - "description": "The first coordinate[1] is the S, the second coordinate[2] is the T parameter value.", + "description": "Definition from IAI: An IfcTextureVertex is a list of 2 (S, T) texture coordinates.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifctexturevertex.htm" }, "IfcThermalMaterialProperties": { @@ -4820,7 +4820,7 @@ "SpecificHeatCapacity": "Defines the specific heat of the material: heat energy absorbed per temperature unit. Usually measured in [J/kg K].", "ThermalConductivity": "The rate at which thermal energy is transmitted through the material.Usually in [W/m K]." }, - "description": "The rate at which thermal energy is transmitted through the material.Usually in [W/m K].", + "description": "A container class with material thermal properties defined in IFC specification.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcthermalmaterialproperties.htm" }, "IfcTimeSeries": { @@ -4835,7 +4835,7 @@ "Unit": "The unit to be assigned to all values within the time series. Note that mixing units is not allowed. If the value is not given, the global unit for the type of _IfcValue_, as defined at _IfcProject.UnitsInContext_ is used.", "UserDefinedDataOrigin": "Value of the data origin if DataOrigin attribute is USERDEFINED." }, - "description": "", + "description": "A time series is a set of a time-stamped data entries. It allows a natural association of data collected over intervals of time. Time series can be regular or irregular. In regular time series data arrive predictably at predefined intervals. In irregular time series some or all time stamps do not follow a repetitive pattern and unpredictable bursts of data may arrive at unspecified points in time.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifctimeseries.htm" }, "IfcTimeSeriesReferenceRelationship": { @@ -4843,23 +4843,23 @@ "ReferencedTimeSeries": "", "TimeSeriesReferences": "" }, - "description": "", + "description": "Relationship assigning documentation references to time series.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifctimeseriesreferencerelationship.htm" }, "IfcTimeSeriesSchedule": { "attributes": { - "ApplicableDates": "Defines an ordered list of the dates for which the time-series data are applicable. For example, the definition of all public holiday dates for a given year allows the formulation of a \"holiday\" occupancy schedule from overall occupancy data. Local time can be used if the dates are not bound to a particular year. > IFC2x2 Addendum 1 change: The attribute has been changed to be optional ", + "ApplicableDates": "Defines an ordered list of the dates for which the time-series data are applicable. For example, the definition of all public holiday dates for a given year allows the formulation of a \"holiday\" occupancy schedule from overall occupancy data. Local time can be used if the dates are not bound to a particular year.", "TimeSeries": "The time series is used to represent the values at discrete points in time that define the schedule. For example, a 24-hour occupancy schedule would be a regular time series with a start time at midnight, end time at (the following) midnight, and with 24 values indicating the occupancy load for each hour of the 24-hour period.", "TimeSeriesScheduleType": "Defines the type of schedule, such as daily, weekly, monthly or annually." }, - "description": "The time series is used to represent the values at discrete points in time that define the schedule. For example, a 24-hour occupancy schedule would be a regular time series with a start time at midnight, end time at (the following) midnight, and with 24 values indicating the occupancy load for each hour of the 24-hour period.", + "description": "The IfcTimeSeriesSchedule defines a time-series that is applicable to to one or more calendar dates. It typically contains a periodically repetitive time series used to define the schedule, facilitating the capture of hours of operation, occupancy loads, etc.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifccontrolextension/lexical/ifctimeseriesschedule.htm" }, "IfcTimeSeriesValue": { "attributes": { "ListValues": "A list of time-series values. At least one value is required." }, - "description": "A list of time-series values. At least one value is required.", + "description": "A time series value is a list of values that comprise the time series. At least one value must be supplied. Applications are expected to normalize values by applying the following three rules:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctimeseriesresource/lexical/ifctimeseriesvalue.htm" }, "IfcTopologicalRepresentationItem": { @@ -4874,7 +4874,7 @@ "attributes": { "PredefinedType": "Identifies the predefined types of transformer from which the type required may be set." }, - "description": "Identifies the predefined types of transformer from which the type required may be set.", + "description": "An IfcTransformerType defines a particular type of transformer that is an inductive stationary device that transfers electrical energy from one circuit to another.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcelectricaldomain/lexical/ifctransformertype.htm" }, "IfcTransportElement": { @@ -4883,14 +4883,14 @@ "CapacityByWeight": "Capacity of the transport element measured by weight.", "OperationType": "Predefined type for transport element." }, - "description": "Capacity of the transportation element measured in numbers of person.", + "description": "Generalization of all transport related objects that move people, animals or goods within a building or building complex. The IfcTransportElement defines the occurrence of a covering type, that (if given) is expressed by the IfcTransportElementType.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifctransportelement.htm" }, "IfcTransportElementType": { "attributes": { "PredefinedType": "Predefined types to define the particular type of the transport element. There may be property set definitions available for each predefined type." }, - "description": "Predefined types to define the particular type of the transport element. There may be property set definitions available for each predefined type.", + "description": "The element type (IfcTransportElementType) defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcproductextension/lexical/ifctransportelementtype.htm" }, "IfcTrapeziumProfileDef": { @@ -4900,7 +4900,7 @@ "TopXOffset": "Offset from the beginning of the top line to the bottom line, measured along the implicit x-axis.", "YDim": "The extent of the distance between the parallel bottom and top lines measured along the implicit y-axis." }, - "description": "Offset from the beginning of the top line to the bottom line, measured along the implicit x-axis.", + "description": "Definition from IAI: The IfcTrapeziumProfileDef defines a trapezium as the profile definition used by the swept surface geometry or the swept area solid. It is given by its Top X and Bottom X extent and its Y extent as well as by the offset of the Top X extend, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system, i.e. in the center of the bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifctrapeziumprofiledef.htm" }, "IfcTrimmedCurve": { @@ -4911,30 +4911,30 @@ "Trim1": "The first trimming point which may be specified as a Cartesian point, as a real parameter or both.", "Trim2": "The second trimming point which may be specified as a Cartesian point, as a real parameter or both." }, - "description": "Where both parameter and point are present at either end of the curve this indicates the preferred form.", + "description": "Definition from ISO/CD 10303-42:1992: A trimmed curve is a bounded curve which is created by taking a selected portion, between two identified points, of the associated basis curve. The basis curve itself is unaltered and more than one trimmed curve may reference the same basis curve. Trimming points for the curve may be identified by:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifctrimmedcurve.htm" }, "IfcTubeBundleType": { "attributes": { "PredefinedType": "Defines the type of tube bundle." }, - "description": "Defines the type of tube bundle.", + "description": "The element type IfcTubeBundleType defines a list of commonly shared property set definitions of a tube buncle and an optional set of product representations. It is used to define a tube bundle specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifctubebundletype.htm" }, "IfcTwoDirectionRepeatFactor": { "attributes": { "SecondRepeatFactor": "A vector which specifies the relative positioning of tiles in the second direction." }, - "description": "A vector which specifies the relative positioning of tiles in the second direction.", + "description": "Definition from ISO/CD 10303-46:1992: A two direction repeat factor combines two vectors which are used in the fill area style tiles entity for determining the shape and relative location of tiles. Given the initial position of any tile, the two direction repeat factor determines eight new positions according to the equation:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationappearanceresource/lexical/ifctwodirectionrepeatfactor.htm" }, "IfcTypeObject": { "attributes": { "ApplicableOccurrence": "The attribute optionally defines the data type of the occurrence object, to which the assigned type object can relate. If not present, no instruction is given to which occurrence object the type object is applicable.", - "HasPropertySets": "Set ~~list~~ of unique property sets, that are associated with the object type and are common to all object occurrences referring to this object type. > IFC2x Edition 3 CHANGE  The attribute aggregate type has been changed from LIST to SET. ", + "HasPropertySets": "Set ~~list~~ of unique property sets, that are associated with the object type and are common to all object occurrences referring to this object type.", "ObjectTypeOf": "Reference to the relationship IfcRelDefinedByType and thus to those occurrence objects, which are defined by this type." }, - "description": "Reference to the relationship IfcRelDefinedByType and thus to those occurrence objects, which are defined by this type.", + "description": "The object type (IfcTypeObject) defines the specific information about a type. It refers to the specific level of the well recognized generic - specific - occurrence modeling paradigm.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifctypeobject.htm" }, "IfcTypeProduct": { @@ -4942,12 +4942,12 @@ "RepresentationMaps": "List of unique representation maps. Each representation map describes a block definition of the shape of the product style. By providing more than one representation map, a multi-view block definition can be given.", "Tag": "The tag (or label) identifier at the particular type of a product, e.g. the article number (like the EAN). It is the identifier at the specific level." }, - "description": "The tag (or label) identifier at the particular type of a product, e.g. the article number (like the EAN). It is the identifier at the specific level.", + "description": "The product type (IfcTypeProduct) defines a list of property set definitions of a product and an optional set of product representations. It is used to define a product specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifckernel/lexical/ifctypeproduct.htm" }, "IfcUShapeProfileDef": { "attributes": { - "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "CentreOfGravityInX": "Location of centre of gravity along the x axis measured from the center of the bounding box.", "Depth": "Web lengths, see illustration above (= h).", "EdgeRadius": "Edge radius according the above illustration (= r2). If it is not given, zero is assumed.", "FilletRadius": "Fillet radius according the above illustration (= r1). If it is not given, zero is assumed.", @@ -4956,28 +4956,28 @@ "FlangeWidth": "Flange lengths, see illustration above (= b).", "WebThickness": "Constant wall thickness of web (= ts)." }, - "description": "Location of centre of gravity along the x axis measured from the center of the bounding box. > IFC2x Edition 2 Addendum 2 CHANGE The attribute CentreOfGravityInX has been made optional. Upward compatibility for file based exchange is guaranteed. ", + "description": "The IfcUShapeProfileDef defines a section profile that provides the defining parameters of a U-shape (channel) section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the\\^profiles centre of the ~~gravity~~ bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifcushapeprofiledef.htm" }, "IfcUnitAssignment": { "attributes": { "Units": "Units to be included within a unit assignment." }, - "description": "Units to be included within a unit assignment.", + "description": "A set of units which may be assigned. Within an IfcUnitAssigment each unit definition shall be unique. I.e. there shall be no redundant unit definitions for the same unit type, like length unit, area unit etc. For currencies, there shall be only a single IfcMonetaryUnit within an IfcUnitAssignment.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmeasureresource/lexical/ifcunitassignment.htm" }, "IfcUnitaryEquipmentType": { "attributes": { "PredefinedType": "The type of unitary equipment." }, - "description": "The type of unitary equipment.", + "description": "The element type IfcUnitaryEquipmentType defines a list of commonly shared property set definitions of a unitary equipment element and an optional set of product representations. It is used to define a unitary equipment element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcunitaryequipmenttype.htm" }, "IfcValveType": { "attributes": { "PredefinedType": "The type of valve." }, - "description": "The type of valve.", + "description": "The element type IfcValveType defines a list of commonly shared property set definitions of a valve and an optional set of product representations. It is used to define a valve specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcvalvetype.htm" }, "IfcVector": { @@ -4986,7 +4986,7 @@ "Magnitude": "The magnitude of the vector. All vectors of Magnitude 0.0 are regarded as equal in value regardless of the orientation attribute.", "Orientation": "The direction of the vector." }, - "description": "The space dimensionality of this class, it is derived from Orientation Orientation.Dim", + "description": "Definition from ISO/CD 10303-42:1992: The vector is defined in terms of the direction and magnitude of the vector. The value of the magnitude attribute defines the magnitude of the vector.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometryresource/lexical/ifcvector.htm" }, "IfcVertex": { @@ -4998,28 +4998,28 @@ "TexturePoints": "Reference to a list of polyloop's defining a face bound of a face within a vertex based geometry.", "TextureVertices": "List of texture vertex coordinates, each texture vertex refers to the Cartesian point within the polyloop (corresponding lists). The first coordinate[1] is the S, the second coordinate[2] is the T parameter value." }, - "description": "Reference to a list of polyloop's defining a face bound of a face within a vertex based geometry.", + "description": "Definition from IAI: An IfcVertexBasedTextureMap provides the mapping of the 2-dimensional texture coordinates (S, T) to the vertices of a single surface onto which it is mapped. For each vertex coordinates, provided by IfcCartesianPoin, a set of 2 (S, T) texture coordinates are given.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcpresentationdefinitionresource/lexical/ifcvertexbasedtexturemap.htm" }, "IfcVertexLoop": { "attributes": { "LoopVertex": "The vertex which defines the entire loop." }, - "description": "The vertex which defines the entire loop.", + "description": "Definition from ISO/CD 10303-42:1992: A vertex_loop is a loop of zero genus consisting of a single vertex. A vertex can exist independently of a vertex loop. The topological data shall satisfy the following constraint:", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcvertexloop.htm" }, "IfcVertexPoint": { "attributes": { "VertexGeometry": "The geometric point, which defines the position in geometric space of the vertex." }, - "description": "The geometric point, which defines the position in geometric space of the vertex.", + "description": "Definition from ISO/CD 10303-42:1992: A vertex point is a vertex which has its geometry defined as a point.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifctopologyresource/lexical/ifcvertexpoint.htm" }, "IfcVibrationIsolatorType": { "attributes": { "PredefinedType": "Defines the type of vibration isolator." }, - "description": "Defines the type of vibration isolator.", + "description": "The element type IfcVibrationIsolatorType defines a list of commonly shared property set definitions of a vibration isolator and an optional set of product representations. It is used to define a vibration isolator specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifchvacdomain/lexical/ifcvibrationisolatortype.htm" }, "IfcVirtualElement": { @@ -5031,7 +5031,7 @@ "IntersectingAxes": "Two grid axes which intersects at exactly one intersection (see also informal proposition at IfcGrid). If attribute OffsetDistances is omitted, the intersection defines the placement or ref direction of a grid placement directly. If OffsetDistances are given, the intersection is defined by the offset curves to the grid axes.", "OffsetDistances": "Offset distances to the grid axes. If given, it defines virtual offset curves to the grid axes. The intersection of the offset curves specify the virtual grid intersection." }, - "description": "Offset distances to the grid axes. If given, it defines virtual offset curves to the grid axes. The intersection of the offset curves specify the virtual grid intersection.", + "description": "The IfcVirtualGridIntersection defines the derived location of the intersection between two grid axes. Offset values may be given to set an offset distance to the grid axis for the calculation of the virtual grid intersection.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcgeometricconstraintresource/lexical/ifcvirtualgridintersection.htm" }, "IfcWall": { @@ -5046,14 +5046,14 @@ "attributes": { "PredefinedType": "Identifies the predefined types of a wall element from which the type required may be set." }, - "description": "Identifies the predefined types of a wall element from which the type required may be set.", + "description": "The element type (IfcWallType) defines a list of commonly shared property set definitions of a wall and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcwalltype.htm" }, "IfcWasteTerminalType": { "attributes": { "PredefinedType": "Identifies the predefined types of waste terminal from which the type required may be set." }, - "description": "Identifies the predefined types of waste terminal from which the type required may be set.", + "description": "The IfcWasteTerminalType defines a particular type of sanitary flow that has the purpose of collecting or intercepting waste from one or more sanitary terminals or other fluid waste generating equipment and discharging it into a single waste/drainage system.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcplumbingfireprotectiondomain/lexical/ifcwasteterminaltype.htm" }, "IfcWaterProperties": { @@ -5066,15 +5066,15 @@ "IsPotable": "If TRUE, then the water is considered potable.", "PHLevel": "Maximum water ph in a range from 0-14." }, - "description": "Fraction of the dissolved solids to the total amount of water. This is measured in weight of dissolved solids per weight of water and is therefore unitless.", + "description": "Common definition to capture the properties of water typically used within the context of building services and flow distribution systems.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcmaterialpropertyresource/lexical/ifcwaterproperties.htm" }, "IfcWindow": { "attributes": { - "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the ~~body of the~~ window opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE  The body of the window might be taller then the window opening (e.g. in cases where the window lining includes a casing). In these cases the OverallHeight shall still be given as the window opening height, and not as the total height of the window lining.", - "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ window opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE  The body of the window might be wider then the window opening (e.g. in cases where the window lining includes a casing). In these cases the OverallWidth shall still be given as the window opening width, and not as the total width of the window lining." + "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the ~~body of the~~ window opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE The body of the window might be taller then the window opening (e.g. in cases where the window lining includes a casing). In these cases the OverallHeight shall still be given as the window opening height, and not as the total height of the window lining.", + "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ window opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE The body of the window might be wider then the window opening (e.g. in cases where the window lining includes a casing). In these cases the OverallWidth shall still be given as the window opening width, and not as the total width of the window lining." }, - "description": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ window opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE  The body of the window might be wider then the window opening (e.g. in cases where the window lining includes a casing). In these cases the OverallWidth shall still be given as the window opening width, and not as the total width of the window lining.", + "description": "Definition form ISO 6707-1:1989: Construction for closing a vertical or near vertical opening in a wall or pitched roof that will admit light and may admit fresh air.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcwindow.htm" }, "IfcWindowLiningProperties": { @@ -5089,7 +5089,7 @@ "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the lining.", "TransomThickness": "Thickness of the transom (horizontal separator of window panels within a window), measured parallel to the window elevation plane. The transom is part of the lining and the transom depth is assumed to be identical to the lining depth." }, - "description": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the lining.", + "description": "The window lining is the frame which enables the window to be fixed in position. The window lining is used to hold the window panels or other casements. The parameter of the window lining (IfcWindowLiningProperties) define the geometrically relevant parameter of the lining.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcwindowliningproperties.htm" }, "IfcWindowPanelProperties": { @@ -5100,7 +5100,7 @@ "PanelPosition": "Position of this panel within the overall window style.", "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the panel." }, - "description": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the panel.", + "description": "A description of the window panel. A window panel is a casement, i.e. a component, fixed or opening, consisting essentially of a frame and the infilling. The infilling of a window panel is normally glazing. The way of operation is defined in the operation type.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcwindowpanelproperties.htm" }, "IfcWindowStyle": { @@ -5110,7 +5110,7 @@ "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value.", "Sizeable": "The Boolean indicates, whether the attached ShapeStyle can be sized (using scale factor of transformation), or not (FALSE). If not, the ShapeStyle should be inserted by the IfcWindow (using IfcMappedItem) with the scale factor = 1." }, - "description": "The Boolean indicates, whether the attached ShapeStyle can be sized (using scale factor of transformation), or not (FALSE). If not, the ShapeStyle should be inserted by the IfcWindow (using IfcMappedItem) with the scale factor = 1.", + "description": "The window style defines a particular style of windows, which may be included into the spatial context of the building model through an (or multiple) instances of IfcWindow. A window style defines the overall parameter of the window style and refers to the particular parameter of the lining and one (or several) panels through the IfcWindowLiningProperties and the IfcWindowPanelProperties.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcsharedbldgelements/lexical/ifcwindowstyle.htm" }, "IfcWorkControl": { @@ -5126,7 +5126,7 @@ "UserDefinedControlType": "A user defined work control type.", "WorkControlType": "Predefined work control types from which that required may be set." }, - "description": "A user defined work control type.", + "description": "An IfcWorkControl is an abstract supertype which captures information that is common to both IfcWorkPlan and IfcWorkSchedule", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprocessextension/lexical/ifcworkcontrol.htm" }, "IfcWorkPlan": { @@ -5146,7 +5146,7 @@ "FlangeWidth": "Flange length, see illustration above (= b).", "WebThickness": "Constant wall thickness of web, see illustration above (= ts)." }, - "description": "Edge radius according the above illustration (= r2). If it is not given, zero is assumed.", + "description": "Definition from IAI: The IfcZShapeProfileDef defines a section profile that provides the defining parameters of a Z-shape section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profiles centre of the gravity bounding box.", "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/ifcprofileresource/lexical/ifczshapeprofiledef.htm" }, "IfcZone": { diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_properties.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_properties.json index c1b74718e4..f7abfe34de 100644 --- a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_properties.json +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_properties.json @@ -421,9 +421,7 @@ "SecondaryAirflowRateRange": { "description": "possible range of secondary airflow that can be delivered" }, - "Weight": { - "description": "" - } + "Weight": {} }, "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC2x3/TC1/HTML/psd/IfcHvacDomain/Pset_AirToAirHeatRecoveryTypeCommon.xml" }, @@ -5443,9 +5441,7 @@ "HandicapAccessible": { "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as an accessible space for handicapped people, e.g., for a public toilet (TRUE) or not (FALSE). This information is often used to declare the need for access for the disabled and for special design requirements of this space." }, - "NetPlannedArea": { - "description": "" - }, + "NetPlannedArea": {}, "PubliclyAccessible": { "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as a publicly accessible space, e.g., for a public toilet (TRUE) or not (FALSE)." }, diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_property_sets_site_domains.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_property_sets_site_domains.json new file mode 100644 index 0000000000..c3db781695 --- /dev/null +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc2x3_property_sets_site_domains.json @@ -0,0 +1,319 @@ +{ + "Pset_ActionRequest": "IfcFacilitiesMgmtDomain", + "Pset_ActorCommon": "IfcKernel", + "Pset_ActuatorTypeCommon": "IfcBuildingControlsDomain", + "Pset_ActuatorTypeElectricActuator": "IfcBuildingControlsDomain", + "Pset_ActuatorTypeHydraulicActuator": "IfcBuildingControlsDomain", + "Pset_ActuatorTypeLinearActuation": "IfcBuildingControlsDomain", + "Pset_ActuatorTypePneumaticActuator": "IfcBuildingControlsDomain", + "Pset_ActuatorTypeRotationalActuation": "IfcBuildingControlsDomain", + "Pset_AirSideSystemInformation": "IfcSharedBldgServiceElements", + "Pset_AirTerminalBoxPHistory": "IfcHvacDomain", + "Pset_AirTerminalBoxTypeCommon": "IfcHvacDomain", + "Pset_AirTerminalPHistory": "IfcHvacDomain", + "Pset_AirTerminalTypeCommon": "IfcHvacDomain", + "Pset_AirTerminalTypeRectangular": "IfcHvacDomain", + "Pset_AirTerminalTypeRound": "IfcHvacDomain", + "Pset_AirTerminalTypeSlot": "IfcHvacDomain", + "Pset_AirTerminalTypeSquare": "IfcHvacDomain", + "Pset_AirToAirHeatRecoveryPHist": "IfcHvacDomain", + "Pset_AirToAirHeatRecoveryTypeCommon": "IfcHvacDomain", + "Pset_AnalogInput": "IfcBuildingControlsDomain", + "Pset_AnalogOutput": "IfcBuildingControlsDomain", + "Pset_Asset": "IfcSharedFacilitiesElements", + "Pset_BeamCommon": "IfcSharedBldgElements", + "Pset_BinaryInput": "IfcBuildingControlsDomain", + "Pset_BinaryOutput": "IfcBuildingControlsDomain", + "Pset_BoilerPHistory": "IfcHvacDomain", + "Pset_BoilerTypeCommon": "IfcHvacDomain", + "Pset_BoilerTypeSteam": "IfcHvacDomain", + "Pset_BuildingCommon": "IfcProductExtension", + "Pset_BuildingElementProxyCommon": "IfcProductExtension", + "Pset_BuildingStoreyCommon": "IfcProductExtension", + "Pset_BuildingUse": "IfcProductExtension", + "Pset_BuildingUseAdjacent": "IfcProductExtension", + "Pset_BuildingWaterStorage": "IfcProductExtension", + "Pset_CableCarrierSegmentTypeCableLadderSegment": "IfcElectricalDomain", + "Pset_CableCarrierSegmentTypeCableTraySegment": "IfcElectricalDomain", + "Pset_CableCarrierSegmentTypeCableTrunkingSegment": "IfcElectricalDomain", + "Pset_CableCarrierSegmentTypeConduitSegment": "IfcElectricalDomain", + "Pset_CableSegmentTypeCableSegment": "IfcElectricalDomain", + "Pset_CableSegmentTypeConductorSegment": "IfcElectricalDomain", + "Pset_ChillerPHistory": "IfcHvacDomain", + "Pset_ChillerTypeCommon": "IfcHvacDomain", + "Pset_CoilPHistory": "IfcHvacDomain", + "Pset_CoilTypeCommon": "IfcHvacDomain", + "Pset_CoilTypeHydronic": "IfcHvacDomain", + "Pset_ColumnCommon": "IfcSharedBldgElements", + "Pset_CompressorPHistory": "IfcHvacDomain", + "Pset_CompressorTypeCommon": "IfcHvacDomain", + "Pset_ConcreteElementGeneral": "IfcStructuralElementsDomain", + "Pset_ConcreteElementQuantityGeneral": "IfcStructuralElementsDomain", + "Pset_ConcreteElementSurfaceFinishQuantityGeneral": "IfcStructuralElementsDomain", + "Pset_CondenserPHistory": "IfcHvacDomain", + "Pset_CondenserTypeCommon": "IfcHvacDomain", + "Pset_ControllerTypeCommon": "IfcBuildingControlsDomain", + "Pset_ControllerTypeProportional": "IfcBuildingControlsDomain", + "Pset_ControllerTypeTwoPosition": "IfcBuildingControlsDomain", + "Pset_CooledBeamPHistory": "IfcHvacDomain", + "Pset_CooledBeamPHistoryActive": "IfcHvacDomain", + "Pset_CooledBeamTypeActive": "IfcHvacDomain", + "Pset_CooledBeamTypeCommon": "IfcHvacDomain", + "Pset_CoolingTowerPHistory": "IfcHvacDomain", + "Pset_CoolingTowerTypeCommon": "IfcHvacDomain", + "Pset_CoveringCeiling": "IfcProductExtension", + "Pset_CoveringCommon": "IfcProductExtension", + "Pset_CoveringFlooring": "IfcProductExtension", + "Pset_CurtainWallCommon": "IfcSharedBldgElements", + "Pset_DamperPHistory": "IfcHvacDomain", + "Pset_DamperTypeCommon": "IfcHvacDomain", + "Pset_DamperTypeControlDamper": "IfcHvacDomain", + "Pset_DamperTypeFireDamper": "IfcHvacDomain", + "Pset_DamperTypeFireSmokeDamper": "IfcHvacDomain", + "Pset_DamperTypeSmokeDamper": "IfcHvacDomain", + "Pset_DesignPoint": "IfcPlumbingFireProtectionDomain", + "Pset_DiscreteAccessoryAnchorBolt": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryColumnShoe": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryCornerFixingPlate": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryDiagonalTrussConnector": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryEdgeFixingPlate": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryFixingSocket": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryLadderTrussConnector": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryStandardFixingPlate": "IfcSharedComponentElements", + "Pset_DiscreteAccessoryWireLoop": "IfcSharedComponentElements", + "Pset_DistributionChamberElementTypeFormedDuct": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeInspectionChamber": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeInspectionPit": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeManhole": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeMeterChamber": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeSump": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeTrench": "IfcSharedBldgServiceElements", + "Pset_DistributionChamberElementTypeValveChamber": "IfcSharedBldgServiceElements", + "Pset_DistributionFlowElementCommon": "IfcSharedBldgServiceElements", + "Pset_DistributionPortDuct": "IfcSharedBldgServiceElements", + "Pset_DistributionPortPipe": "IfcSharedBldgServiceElements", + "Pset_DoorCommon": "IfcSharedBldgElements", + "Pset_DoorWindowGlazingType": "IfcSharedBldgElements", + "Pset_DoorWindowShadingType": "IfcSharedBldgElements", + "Pset_DrainageCatchment": "IfcPlumbingFireProtectionDomain", + "Pset_DrainageCulvert": "IfcPlumbingFireProtectionDomain", + "Pset_DrainageOutfall": "IfcPlumbingFireProtectionDomain", + "Pset_DrainageReserve": "IfcPlumbingFireProtectionDomain", + "Pset_Draughting": "IfcProductExtension", + "Pset_DuctConnection": "IfcHvacDomain", + "Pset_DuctDesignCriteria": "IfcHvacDomain", + "Pset_DuctFittingPHistory": "IfcHvacDomain", + "Pset_DuctFittingTypeCommon": "IfcHvacDomain", + "Pset_DuctSegmentPHistory": "IfcHvacDomain", + "Pset_DuctSegmentTypeCommon": "IfcHvacDomain", + "Pset_DuctSilencerPHistory": "IfcHvacDomain", + "Pset_DuctSilencerTypeCommon": "IfcHvacDomain", + "Pset_ElectricDistributionPointCommon": "IfcElectricalDomain", + "Pset_ElectricGeneratorTypeCommon": "IfcElectricalDomain", + "Pset_ElectricHeaterTypeElectricalCableHeater": "IfcElectricalDomain", + "Pset_ElectricHeaterTypeElectricalMatHeater": "IfcElectricalDomain", + "Pset_ElectricHeaterTypeElectricalPointHeater": "IfcElectricalDomain", + "Pset_ElectricMotorTypeCommon": "IfcElectricalDomain", + "Pset_ElectricalCircuit": "IfcElectricalDomain", + "Pset_ElectricalDeviceCommon": "IfcElectricalDomain", + "Pset_ElementShading": "IfcProductExtension", + "Pset_EnergyConsumptionPHistoryElectricity": "IfcHvacDomain", + "Pset_EnergyConsumptionPHistoryFuel": "IfcHvacDomain", + "Pset_EnergyConsumptionPHistorySteam": "IfcHvacDomain", + "Pset_EnergyConversionDeviceCoil": "IfcSharedBldgServiceElements", + "Pset_EnergyConversionDeviceSpaceHeaterPanel": "IfcSharedBldgServiceElements", + "Pset_EnergyConversionDeviceSpaceHeaterSectional": "IfcSharedBldgServiceElements", + "Pset_EvaporativeCoolerPHistory": "IfcHvacDomain", + "Pset_EvaporativeCoolerTypeCommon": "IfcHvacDomain", + "Pset_EvaporatorPHistory": "IfcHvacDomain", + "Pset_EvaporatorTypeCommon": "IfcHvacDomain", + "Pset_FanPHistory": "IfcHvacDomain", + "Pset_FanTypeCommon": "IfcHvacDomain", + "Pset_FanTypeSmokeControl": "IfcHvacDomain", + "Pset_FilterPHistory": "IfcHvacDomain", + "Pset_FilterTypeAirParticleFilter": "IfcHvacDomain", + "Pset_FilterTypeCommon": "IfcHvacDomain", + "Pset_FireRatingProperties": "IfcSharedBldgServiceElements", + "Pset_FireSuppressionTerminalTypeBreechingInlet": "IfcPlumbingFireProtectionDomain", + "Pset_FireSuppressionTerminalTypeFireHydrant": "IfcPlumbingFireProtectionDomain", + "Pset_FireSuppressionTerminalTypeHoseReel": "IfcPlumbingFireProtectionDomain", + "Pset_FireSuppressionTerminalTypeSprinkler": "IfcPlumbingFireProtectionDomain", + "Pset_FlowControllerDamper": "IfcSharedBldgServiceElements", + "Pset_FlowControllerFlowMeter": "IfcSharedBldgServiceElements", + "Pset_FlowFittingDuctFitting": "IfcSharedBldgServiceElements", + "Pset_FlowFittingPipeFitting": "IfcSharedBldgServiceElements", + "Pset_FlowInstrumentTypePressureGauge": "IfcBuildingControlsDomain", + "Pset_FlowInstrumentTypeThermometer": "IfcBuildingControlsDomain", + "Pset_FlowMeterTypeCommon": "IfcHvacDomain", + "Pset_FlowMeterTypeEnergyMeter": "IfcHvacDomain", + "Pset_FlowMeterTypeGasMeter": "IfcHvacDomain", + "Pset_FlowMeterTypeOilMeter": "IfcHvacDomain", + "Pset_FlowMeterTypeWaterMeter": "IfcHvacDomain", + "Pset_FlowMovingDeviceCompressor": "IfcSharedBldgServiceElements", + "Pset_FlowMovingDeviceFan": "IfcSharedBldgServiceElements", + "Pset_FlowMovingDeviceFanCentrifugal": "IfcSharedBldgServiceElements", + "Pset_FlowMovingDevicePump": "IfcSharedBldgServiceElements", + "Pset_FlowSegmentDuctSegment": "IfcSharedBldgServiceElements", + "Pset_FlowSegmentPipeSegment": "IfcSharedBldgServiceElements", + "Pset_FlowStorageDeviceTank": "IfcSharedBldgServiceElements", + "Pset_FlowTerminalAirTerminal": "IfcSharedBldgServiceElements", + "Pset_FurnitureTypeChair": "IfcSharedFacilitiesElements", + "Pset_FurnitureTypeCommon": "IfcSharedFacilitiesElements", + "Pset_FurnitureTypeDesk": "IfcSharedFacilitiesElements", + "Pset_FurnitureTypeFileCabinet": "IfcSharedFacilitiesElements", + "Pset_FurnitureTypeTable": "IfcSharedFacilitiesElements", + "Pset_GasTerminalPHistory": "IfcHvacDomain", + "Pset_GasTerminalTypeCommon": "IfcHvacDomain", + "Pset_GasTerminalTypeGasAppliance": "IfcHvacDomain", + "Pset_GasTerminalTypeGasBurner": "IfcHvacDomain", + "Pset_HeatExchangerTypeCommon": "IfcHvacDomain", + "Pset_HeatExchangerTypePlate": "IfcHvacDomain", + "Pset_HumidifierPHistory": "IfcHvacDomain", + "Pset_HumidifierTypeCommon": "IfcHvacDomain", + "Pset_LampTypeCommon": "IfcElectricalDomain", + "Pset_LightFixtureTypeCommon": "IfcElectricalDomain", + "Pset_LightFixtureTypeExitSign": "IfcElectricalDomain", + "Pset_LightFixtureTypeThermal": "IfcElectricalDomain", + "Pset_ManufacturerOccurrence": "IfcSharedFacilitiesElements", + "Pset_ManufacturerTypeInformation": "IfcSharedFacilitiesElements", + "Pset_MemberCommon": "IfcSharedBldgElements", + "Pset_MultiStateInput": "IfcBuildingControlsDomain", + "Pset_MultiStateOutput": "IfcBuildingControlsDomain", + "Pset_OpeningElementCommon": "IfcProductExtension", + "Pset_OutletTypeCommon": "IfcElectricalDomain", + "Pset_OutsideDesignCriteria": "IfcSharedBldgServiceElements", + "Pset_PackingInstructions": "IfcFacilitiesMgmtDomain", + "Pset_Permit": "IfcFacilitiesMgmtDomain", + "Pset_PipeConnection": "IfcHvacDomain", + "Pset_PipeConnectionFlanged": "IfcHvacDomain", + "Pset_PipeFittingPHistory": "IfcHvacDomain", + "Pset_PipeFittingTypeCommon": "IfcHvacDomain", + "Pset_PipeSegmentPHistory": "IfcHvacDomain", + "Pset_PipeSegmentTypeCommon": "IfcHvacDomain", + "Pset_PipeSegmentTypeGutter": "IfcHvacDomain", + "Pset_PlateCommon": "IfcSharedBldgElements", + "Pset_PrecastConcreteElementGeneral": "IfcStructuralElementsDomain", + "Pset_ProductRequirements": "IfcKernel", + "Pset_ProjectCommon": "IfcKernel", + "Pset_ProjectOrderChangeOrder": "IfcSharedMgmtElements", + "Pset_ProjectOrderMaintenanceWorkOrder": "IfcSharedMgmtElements", + "Pset_ProjectOrderMoveOrder": "IfcSharedMgmtElements", + "Pset_ProjectOrderPurchaseOrder": "IfcSharedMgmtElements", + "Pset_ProjectOrderWorkOrder": "IfcSharedMgmtElements", + "Pset_ProjectionElementShadingDevicePHistory": "IfcHvacDomain", + "Pset_PropertyAgreement": "IfcSharedFacilitiesElements", + "Pset_ProtectiveDeviceTypeCircuitBreaker": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeCommon": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeEarthFailureDevice": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeFuseDisconnector": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeResidualCurrentCircuitBreaker": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeResidualCurrentSwitch": "IfcElectricalDomain", + "Pset_ProtectiveDeviceTypeVaristor": "IfcElectricalDomain", + "Pset_PumpPHistory": "IfcHvacDomain", + "Pset_PumpTypeCommon": "IfcHvacDomain", + "Pset_QuantityTakeOff": "IfcProductExtension", + "Pset_RailingCommon": "IfcSharedBldgElements", + "Pset_RampCommon": "IfcSharedBldgElements", + "Pset_RampFlightCommon": "IfcSharedBldgElements", + "Pset_ReinforcementBarCountOfIndependentFooting": "IfcStructuralElementsDomain", + "Pset_ReinforcementBarPitchOfBeam": "IfcStructuralElementsDomain", + "Pset_ReinforcementBarPitchOfColumn": "IfcStructuralElementsDomain", + "Pset_ReinforcementBarPitchOfContinuousFooting": "IfcStructuralElementsDomain", + "Pset_ReinforcementBarPitchOfSlab": "IfcStructuralElementsDomain", + "Pset_ReinforcementBarPitchOfWall": "IfcStructuralElementsDomain", + "Pset_ReinforcingBarBendingsBECCommon": "IfcStructuralElementsDomain", + "Pset_ReinforcingBarBendingsBS8666Common": "IfcStructuralElementsDomain", + "Pset_ReinforcingBarBendingsDIN135610Common": "IfcStructuralElementsDomain", + "Pset_ReinforcingBarBendingsISOCD3766Common": "IfcStructuralElementsDomain", + "Pset_Reliability": "IfcSharedFacilitiesElements", + "Pset_Risk": "IfcSharedFacilitiesElements", + "Pset_RoofCommon": "IfcSharedBldgElements", + "Pset_SanitaryTerminalTypeBath": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeBidet": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeCistern": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeSanitaryFountain": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeShower": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeSink": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeToiletPan": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeUrinal": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeWCSeat": "IfcPlumbingFireProtectionDomain", + "Pset_SanitaryTerminalTypeWashHandBasin": "IfcPlumbingFireProtectionDomain", + "Pset_SensorTypeCO2Sensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeFireSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeGasSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeHeatSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeHumiditySensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeLightSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeMovementSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypePressureSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeSmokeSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeSoundSensor": "IfcBuildingControlsDomain", + "Pset_SensorTypeTemperatureSensor": "IfcBuildingControlsDomain", + "Pset_SiteCommon": "IfcProductExtension", + "Pset_SlabCommon": "IfcSharedBldgElements", + "Pset_SpaceCommon": "IfcProductExtension", + "Pset_SpaceFireSafetyRequirements": "IfcProductExtension", + "Pset_SpaceHeaterPHistoryCommon": "IfcHvacDomain", + "Pset_SpaceHeaterTypeCommon": "IfcHvacDomain", + "Pset_SpaceHeaterTypeHydronic": "IfcHvacDomain", + "Pset_SpaceLightingRequirements": "IfcProductExtension", + "Pset_SpaceOccupancyRequirements": "IfcProductExtension", + "Pset_SpaceParking": "IfcProductExtension", + "Pset_SpaceParkingAisle": "IfcProductExtension", + "Pset_SpaceProgramCommon": "IfcArchitectureDomain", + "Pset_SpaceThermalDesign": "IfcSharedBldgServiceElements", + "Pset_SpaceThermalPHistory": "IfcHvacDomain", + "Pset_SpaceThermalRequirements": "IfcProductExtension", + "Pset_StairCommon": "IfcSharedBldgElements", + "Pset_StairFlightCommon": "IfcSharedBldgElements", + "Pset_SwitchingDeviceTypeCommon": "IfcElectricalDomain", + "Pset_SwitchingDeviceTypeContactor": "IfcElectricalDomain", + "Pset_SwitchingDeviceTypeEmergencyStop": "IfcElectricalDomain", + "Pset_SwitchingDeviceTypeStarter": "IfcElectricalDomain", + "Pset_SwitchingDeviceTypeSwitchDisconnector": "IfcElectricalDomain", + "Pset_SwitchingDeviceTypeToggleSwitch": "IfcElectricalDomain", + "Pset_SystemFurnitureElementTypeCommon": "IfcSharedFacilitiesElements", + "Pset_SystemFurnitureElementTypePanel": "IfcSharedFacilitiesElements", + "Pset_SystemFurnitureElementTypeWorkSurface": "IfcSharedFacilitiesElements", + "Pset_TankTypeCommon": "IfcHvacDomain", + "Pset_TankTypeExpansion": "IfcHvacDomain", + "Pset_TankTypePreformed": "IfcHvacDomain", + "Pset_TankTypePressureVessel": "IfcHvacDomain", + "Pset_TankTypeSectional": "IfcHvacDomain", + "Pset_ThermalLoadAggregate": "IfcSharedBldgServiceElements", + "Pset_ThermalLoadDesignCriteria": "IfcSharedBldgServiceElements", + "Pset_TransformerTypeCommon": "IfcElectricalDomain", + "Pset_TransportElementCommon": "IfcProductExtension", + "Pset_TransportElementElevator": "IfcProductExtension", + "Pset_TubeBundleTypeCommon": "IfcHvacDomain", + "Pset_TubeBundleTypeFinned": "IfcHvacDomain", + "Pset_UnitaryEquipmentTypeAirConditioningUnit": "IfcHvacDomain", + "Pset_UnitaryEquipmentTypeAirHandler": "IfcHvacDomain", + "Pset_UtilityConsumption": "IfcSharedBldgServiceElements", + "Pset_ValvePHistory": "IfcHvacDomain", + "Pset_ValveTypeAirRelease": "IfcHvacDomain", + "Pset_ValveTypeCommon": "IfcHvacDomain", + "Pset_ValveTypeDrawOffCock": "IfcHvacDomain", + "Pset_ValveTypeFaucet": "IfcHvacDomain", + "Pset_ValveTypeFlushing": "IfcHvacDomain", + "Pset_ValveTypeGasTap": "IfcHvacDomain", + "Pset_ValveTypeIsolating": "IfcHvacDomain", + "Pset_ValveTypeMixing": "IfcHvacDomain", + "Pset_ValveTypePressureReducing": "IfcHvacDomain", + "Pset_ValveTypePressureRelief": "IfcHvacDomain", + "Pset_VibrationIsolatorTypeCommon": "IfcHvacDomain", + "Pset_WallCommon": "IfcSharedBldgElements", + "Pset_Warranty": "IfcSharedFacilitiesElements", + "Pset_WasteTerminalTypeFloorTrap": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeFloorWaste": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeGreaseInterceptor": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeGullySump": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeGullyTrap": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeOilInterceptor": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypePetrolInterceptor": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeRoofDrain": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeWasteDisposalUnit": "IfcPlumbingFireProtectionDomain", + "Pset_WasteTerminalTypeWasteTrap": "IfcPlumbingFireProtectionDomain", + "Pset_WindowCommon": "IfcSharedBldgElements", + "Pset_ZoneCommon": "IfcProductExtension" +} \ No newline at end of file diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_entities.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_entities.json new file mode 100644 index 0000000000..453fb4cb7d --- /dev/null +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_entities.json @@ -0,0 +1,6158 @@ +{ + "IfcActionRequest": { + "attributes": { + "LongDescription": "Detailed description of the permit.", + "PredefinedType": "Identifies the predefined type of sources through which a request can be made.", + "Status": "The status currently assigned to the request. Possible values include: Hold: wait to see if further requests are received before deciding on action NoAction: no action is required on this request Schedule: plan action to take place as part of maintenance or other task planning/scheduling Urgent: take action immediately" + }, + "description": "A request is the act or instance of asking for something, such as a request for information, bid submission, or performance of work.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/lexical/ifcactionrequest.htm" + }, + "IfcActor": { + "attributes": { + "IsActingUpon": "Reference to the relationship that associates the actor to an object.", + "TheActor": "Information about the actor." + }, + "description": "The IfcActor defines all actors or human agents involved in a project during its full life cycle. It facilitates the use of person and organization definitions in the resource part of the IFC object model. This includes name, address, telecommunication addresses, and roles.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcactor.htm" + }, + "IfcActorRole": { + "attributes": { + "Description": "A textual description relating the nature of the role played by an actor.", + "HasExternalReference": "Reference to external information, e.g. library, classification, or document information, which is associated with the actor role.", + "Role": "The name of the role played by an actor. If the Role has value USERDEFINED, then the user defined role shall be provided as a value of the attribute UserDefinedRole.", + "UserDefinedRole": "Allows for specification of user defined roles beyond the enumeration values provided by Role attribute of type IfcRoleEnum. When a value is provided for attribute UserDefinedRole in parallel the attribute Role shall have enumeration value USERDEFINED." + }, + "description": "This entity indicates a role which is performed by an actor, either a person, an organization or a person related to an organization.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcactorrole.htm" + }, + "IfcActuator": { + "attributes": { + "PredefinedType": "" + }, + "description": "An actuator is a mechanical device for moving or controlling a mechanism or system. An actuator takes energy, usually created by air, electricity, or liquid, and converts that into some kind of motion.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcactuator.htm" + }, + "IfcActuatorType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of actuator from which the type required may be set." + }, + "description": "The distribution control element type IfcActuatorType defines commonly shared information for occurrences of actuators. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcactuatortype.htm" + }, + "IfcAddress": { + "attributes": { + "Description": "Text that relates the nature of the address.", + "OfOrganization": "The inverse relationship to Organization to whom address is associated.", + "OfPerson": "The inverse relationship to Person to whom address is associated.", + "Purpose": "Identifies the logical location of the address.", + "UserDefinedPurpose": "Allows for specification of user specific purpose of the address beyond the enumeration values provided by Purpose attribute of type IfcAddressTypeEnum. When a value is provided for attribute UserDefinedPurpose, in parallel the attribute Purpose shall have enumeration value USERDEFINED." + }, + "description": "This abstract entity represents various kinds of postal and telecom addresses.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcaddress.htm" + }, + "IfcAdvancedBrep": { + "description": "An advanced B-rep is a boundary representation model in which all faces, edges and vertices are explicitly represented. It is a solid with explicit topology and elementary or free-form geometry. The faces of the B-rep are of type IfcAdvancedFace. An advanced B-rep has to meet the same topological constraints as the manifold solid B-rep.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcadvancedbrep.htm" + }, + "IfcAdvancedBrepWithVoids": { + "attributes": { + "Voids": "" + }, + "description": "The IfcAdvancedBrepWithVoids is a specialization of an advanced B-rep which contains one or more voids in its interior. The voids are represented as closed shells which are defined so that the shell normal point into the void.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcadvancedbrepwithvoids.htm" + }, + "IfcAdvancedFace": { + "description": "An advanced face is a specialization of a face surface that has to meet requirements on using particular topological and geometric representation items for the definition of the faces, edges and vertices.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcadvancedface.htm" + }, + "IfcAirTerminal": { + "attributes": { + "PredefinedType": "" + }, + "description": "An air terminal is a terminating or origination point for the transfer of air between distribution system(s) and one or more spaces. It can also be used for the transfer of air between adjacent spaces.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairterminal.htm" + }, + "IfcAirTerminalBox": { + "attributes": { + "PredefinedType": "" + }, + "description": "An air terminal box typically participates in an HVAC duct distribution system and is used to control or modulate the amount of air delivered to its downstream ductwork. An air terminal box type is often referred to as an \"air flow regulator\".", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairterminalbox.htm" + }, + "IfcAirTerminalBoxType": { + "attributes": { + "PredefinedType": "The air terminal box type." + }, + "description": "The flow controller type IfcAirTerminalBoxType defines commonly shared information for occurrences of air terminal boxes. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairterminalboxtype.htm" + }, + "IfcAirTerminalType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The flow terminal type IfcAirTerminalType defines commonly shared information for occurrences of air terminals. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairterminaltype.htm" + }, + "IfcAirToAirHeatRecovery": { + "attributes": { + "PredefinedType": "" + }, + "description": "An air-to-air heat recovery device employs a counter-flow heat exchanger between inbound and outbound air flow. It is typically used to transfer heat from warmer air in one chamber to cooler air in the second chamber (i.e., typically used to recover heat from the conditioned air being exhausted and the outside air being supplied to a building), resulting in energy savings from reduced heating (or cooling) requirements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairtoairheatrecovery.htm" + }, + "IfcAirToAirHeatRecoveryType": { + "attributes": { + "PredefinedType": "Defines the type of air to air heat recovery device." + }, + "description": "The energy conversion device type IfcAirToAirHeatRecoveryType defines commonly shared information for occurrences of air to air heat recoverys. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcairtoairheatrecoverytype.htm" + }, + "IfcAlarm": { + "attributes": { + "PredefinedType": "" + }, + "description": "An alarm is a device that signals the existence of a condition or situation that is outside the boundaries of normal expectation or that activates such a device.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcalarm.htm" + }, + "IfcAlarmType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of alarm from which the type required may be set." + }, + "description": "The distribution control element type IfcAlarmType defines commonly shared information for occurrences of alarms. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcalarmtype.htm" + }, + "IfcAnnotation": { + "attributes": { + "ContainedInStructure": "Relationship to a spatial structure element, to which the associate is primarily associated." + }, + "description": "An annotation is a graphical representation within the geometric (and spatial) context of a project, that adds a note or meaning to the objects which constitutes the project model. Annotations include additional points, curves, text, dimensioning, hatching and other forms of graphical notes. It also include symbolic representations of additional model components, not representing products or spatial structures, such as survey points, contour lines or similar.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcannotation.htm" + }, + "IfcAnnotationFillArea": { + "attributes": { + "InnerBoundaries": "A set of inner curves that define the inner boundaries of the fill area. The areas defined by the inner boundaries are excluded from applying the fill area style.", + "OuterBoundary": "A closed curve that defines the outer boundary of the fill area. The areas defined by the outer boundary (minus potentially defined inner boundaries) is filled by the fill area style." + }, + "description": "The IfcAnnotationFillArea defines an area by a definite OuterBoundary, that might include InnerBoundaries. The areas defined by the InnerBoundaries are excluded from applying the fill area style. The InnerBoundaries shall not intersect with the OuterBoundary nor being outside of the OuterBoundary.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifcannotationfillarea.htm" + }, + "IfcApplication": { + "attributes": { + "ApplicationDeveloper": "Name of the application developer.", + "ApplicationFullName": "The full name of the application as specified by the application developer.", + "ApplicationIdentifier": "Short identifying name for the application.", + "Version": "The version number of this software as specified by the developer of the application." + }, + "description": "IfcApplication holds the information about an IFC compliant application developed by an application developer. The IfcApplication utilizes a short identifying name as provided by the application developer.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcutilityresource/lexical/ifcapplication.htm" + }, + "IfcAppliedValue": { + "attributes": { + "ApplicableDate": "The date on or from which an applied value is applicable.", + "AppliedValue": "The extent or quantity or amount of an applied value.", + "ArithmeticOperator": "The arithmetic operator applied to component values.", + "Category": "Specification of the type of cost used. > NOTE There are many possible types of cost value that may be identified. Whilst there is a broad understanding of the meaning of names that may be assigned to different types of costs, there is no general standard for naming cost types nor are there any broadly defined classifications. To allow for any type of cost value, the _IfcLabel_ datatype is assigned. In the absence of any well defined standard, it is recommended that local agreements should be made to define allowable and understandable cost value types within a project or region.", + "Components": "Optional component values from which _AppliedValue_ is calculated.", + "Condition": "The condition under which a cost value applies. For example, within the context of a bid submission, this may refer to an option that may or may not be elected.", + "Description": "The description that may apply additional information about a cost value.", + "FixedUntilDate": "The date until which applied value is applicable.", + "HasExternalReference": "Reference to an external reference, e.g. library, classification, or document information, that is associated to the IfcAppliedValue.", + "Name": "A name or additional clarification given to a cost value.", + "UnitBasis": "The number and unit of measure on which the unit cost is based. Note: As well as the normally expected units of measure such as length, area, volume etc., costs may be based on units of measure which need to be defined e.g. sack, drum, pallet, item etc. Unit costs may be based on quantities greater (or lesser) than a unitary value of the basis measure. For instance, timber may have a unit cost rate per X meters where X > 1; similarly for cable, piping and many other items. The basis number may be either an integer or a real value. Note: This attribute should be asserted for all circumstances where the cost to be applied is per unit quantity. It may be asserted even for circumstances where an item price is used, in which case the unit cost basis should be by item (or equivalent definition)." + }, + "description": "This entity captures a value driven by a formula, with additional qualifications including unit basis, valid date range, and categorization.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccostresource/lexical/ifcappliedvalue.htm" + }, + "IfcApproval": { + "attributes": { + "ApprovedObjects": "Reference to the _IfcRelAssociatesApproval_ instances associating this approval to objects (subtypes of _IfcRoot_", + "ApprovedResources": "The set of relationships by which resource objects that are are approved by this approval are known.", + "Description": "A general textual description of a design, work task, plan, etc. that is being approved for.", + "GivingApproval": "The actor that is acting in the role specified at _IfcOrganization_ or individually at _IfcPerson_ and giving an approval.", + "HasExternalReferences": "Reference to external references, e.g. library, classification, or document information, that are associated to the Approval.", + "Identifier": "A computer interpretable identifier by which the approval is known.", + "IsRelatedWith": "The set of relationships by which this approval is related to others.", + "Level": "Level of the approval e.g. Draft v.s. Completed design.", + "Name": "A human readable name given to an approval.", + "Qualifier": "Textual description of special constraints or conditions for the approval.", + "Relates": "The set of relationships by which other approvals are related to this one.", + "RequestingApproval": "The actor that is acting in the role specified at _IfcOrganization_ or individually at _IfcPerson_ and requesting an approval.", + "Status": "The result or current status of the approval, e.g. Requested, Processed, Approved, Not Approved.", + "TimeOfApproval": "Date and time when the result of the approval process is produced." + }, + "description": "An IfcApproval represents information about approval processes such as for a plan, a design, a proposal, or a change order in a construction or facilities management project. IfcApproval is referenced by IfcRelAssociatesApproval in IfcControlExtension schema, and thereby can be related to all subtypes of IfcRoot. An approval may also be given to resource objects using IfcResourceApprovalRelationship", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcapprovalresource/lexical/ifcapproval.htm" + }, + "IfcApprovalRelationship": { + "attributes": { + "RelatedApprovals": "The approvals that are related to another (relating) approval.", + "RelatingApproval": "The approval that other approval is related to." + }, + "description": "An IfcApprovalRelationship associates approvals (one relating approval and one or more related approvals), each having different status or level as the approval process or the approved objects evolve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcapprovalresource/lexical/ifcapprovalrelationship.htm" + }, + "IfcArbitraryClosedProfileDef": { + "attributes": { + "OuterCurve": "Bounded curve, defining the outer boundaries of the arbitrary profile." + }, + "description": "The closed profile IfcArbitraryClosedProfileDef defines an arbitrary two-dimensional profile for the use within the swept surface geometry, the swept area solid or a sectioned spine. It is given by an outer boundary from which the surface or solid can be constructed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcarbitraryclosedprofiledef.htm" + }, + "IfcArbitraryOpenProfileDef": { + "attributes": { + "Curve": "Open bounded curve defining the profile." + }, + "description": "The open profile IfcArbitraryOpenProfileDef defines an arbitrary two-dimensional open profile for the use within the swept surface geometry. It is given by an open boundary from which the surface can be constructed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcarbitraryopenprofiledef.htm" + }, + "IfcArbitraryProfileDefWithVoids": { + "attributes": { + "InnerCurves": "Set of bounded curves, defining the inner boundaries of the arbitrary profile." + }, + "description": "The IfcArbitraryProfileDefWithVoids defines an arbitrary closed two-dimensional profile with holes. It is given by an outer boundary and inner boundaries. A common usage of IfcArbitraryProfileDefWithVoids is as the cross section for the creation of swept surfaces or swept solids.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcarbitraryprofiledefwithvoids.htm" + }, + "IfcAsset": { + "attributes": { + "CurrentValue": "The current cost value of the asset.", + "DepreciatedValue": "The current value of an asset within the accounting rules and procedures of an organization.", + "Identification": "A unique identification assigned to an asset that enables its differentiation from other assets. > NOTE The asset identifier is unique within the asset register. It differs from the globally unique id assigned to the instance of an entity populating a database.", + "IncorporationDate": "The date on which an asset was incorporated into the works, installed, constructed, erected or completed. > NOTE This is the date on which an asset is considered to start depreciating.", + "OriginalValue": "The cost value of the asset at the time of purchase.", + "Owner": "The name of the person or organization that 'owns' the asset.", + "ResponsiblePerson": "The person designated to be responsible for the asset. > NOTE In some regulations (for example, UK Health and Safety at Work Act, Electricity at Work Regulations), management of assets must have a person identified as being responsible and to whom regulatory, insurance and other organizations communicate. In places where there is not a legal requirement, the responsible person would be the asset manager but would not have a legal status.", + "TotalReplacementCost": "The total cost of replacement of the asset.", + "User": "The name of the person or organization that 'uses' the asset." + }, + "description": "An asset is a uniquely identifiable grouping of elements acting as a single entity that has a financial value or that can be operated on as a single unit.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcasset.htm" + }, + "IfcAsymmetricIShapeProfileDef": { + "attributes": { + "BottomFlangeEdgeRadius": "Radius of the upper edges of the bottom flange. 0 if sharp-edged, omitted if unknown.", + "BottomFlangeFilletRadius": "The fillet between the web and the bottom flange. 0 if sharp-edged, omitted if unknown.", + "BottomFlangeSlope": "Slope of the upper faces of the bottom flange. Non-zero in case of of tapered bottom flange, 0 in case of parallel bottom flange, omitted if unknown.", + "BottomFlangeThickness": "Flange thickness of the bottom flange.", + "BottomFlangeWidth": "Extent of the bottom flange, defined parallel to the x axis of the position coordinate system.", + "OverallDepth": "Total extent of the depth, defined parallel to the y axis of the position coordinate system.", + "TopFlangeEdgeRadius": "Radius of the lower edges of the top flange. 0 if sharp-edged, omitted if unknown.", + "TopFlangeFilletRadius": "The fillet between the web and the top flange. 0 if sharp-edged, omitted if unknown.", + "TopFlangeSlope": "Slope of the lower faces of the top flange. Non-zero in case of of tapered top flange, 0 in case of parallel top flange, omitted if unknown.", + "TopFlangeThickness": "Flange thickness of the top flange. This attribute is formally optional for historic reasons only. Whenever the flange thickness is known, it shall be provided by value.", + "TopFlangeWidth": "Extent of the top flange, defined parallel to the x axis of the position coordinate system.", + "WebThickness": "Thickness of the web of the I-shape. The web is centred on the x-axis and the y-axis of the position coordinate system." + }, + "description": "IfcAsymmetricIShapeProfileDef defines a section profile that provides the defining parameters of a singly symmetric I-shaped section. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profile's centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcasymmetricishapeprofiledef.htm" + }, + "IfcAudioVisualAppliance": { + "attributes": { + "PredefinedType": "" + }, + "description": "An audio-visual appliance is a device that displays, captures, transmits, or receives audio or video.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcaudiovisualappliance.htm" + }, + "IfcAudioVisualApplianceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of audio-visual appliance from which the type required may be set." + }, + "description": "The flow terminal type IfcAudioVisualApplianceType defines commonly shared information for occurrences of audio visual appliances. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcaudiovisualappliancetype.htm" + }, + "IfcAxis1Placement": { + "attributes": { + "Axis": "The direction of the local Z axis.", + "Z": "The normalized direction of the local Z axis. It is either identical with the Axis value, if given, or it defaults to [0.,0.,1.] NVL (IfcNormalise(Axis), IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcDirection([0.0,0.0,1.0]))" + }, + "description": "The IfcAxis1Placement provides location and direction of a single axis.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcaxis1placement.htm" + }, + "IfcAxis2Placement2D": { + "attributes": { + "P": "_P[1]_: The normalized direction of the placement X Axis. This is [1.0,0.0] if _RefDirection_ is omitted. _P[2]_: The normalized direction of the placement Y Axis. This is a derived attribute and is orthogonal to P[1]. If _RefDirection_ is omitted, it defaults to [0.0,1.0] IfcBuild2Axes(RefDirection)", + "RefDirection": "The direction used to determine the direction of the local X axis. If a value is omited that it defaults to [1.0, 0.0.]." + }, + "description": "The IfcAxis2Placement2D provides location and orientation to place items in a two-dimensional space. The attribute RefDirection defines the x axis, the y axis is derived. If the attribute RefDirection is not given, the placement defaults to P[1] (x-axis) as [1.,0.] and P[2] (y-axis) as [0.,1.].", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcaxis2placement2d.htm" + }, + "IfcAxis2Placement3D": { + "attributes": { + "Axis": "The exact direction of the local Z Axis.", + "P": "The normalized directions of the placement X Axis (P[1]) and the placement Y Axis (P[2]) and the placement Z Axis (P[3]). IfcBuildAxes(Axis, RefDirection)", + "RefDirection": "The direction used to determine the direction of the local X Axis. If necessary an adjustment is made to maintain orthogonality to the Axis direction. If Axis and/or RefDirection is omitted, these directions are taken from the geometric coordinate system." + }, + "description": "The IfcAxis2Placement3D provides location and orientations to place items in a three-dimensional space. The attribute Axis defines the Z direction, RefDirection the X direction. The Y direction is derived.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcaxis2placement3d.htm" + }, + "IfcBSplineCurve": { + "attributes": { + "ClosedCurve": "Indication of whether the curve is closed; it is for information only.", + "ControlPoints": "The array of control points used to define the geometry of the curve. This is derived from the list of control points. IfcListToArray(ControlPointsList,0,UpperIndexOnControlPoints)", + "ControlPointsList": "The list of control points for the curve.", + "CurveForm": "Used to identify particular types of curve; it is for information only.", + "Degree": "The algebraic degree of the basis functions.", + "SelfIntersect": "Indication whether the curve self-intersects or not; it is for information only.", + "UpperIndexOnControlPoints": "The upper index on the array of control points; the lower index is 0. This value is derived from the control points list. (SIZEOF(ControlPointsList) - 1)" + }, + "description": "The IfcBSplineCurve is a spline curve parameterized by spline functions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcbsplinecurve.htm" + }, + "IfcBSplineCurveWithKnots": { + "attributes": { + "KnotMultiplicities": "The multiplicities of the knots. This list defines the number of times each knot in the knots list is to be repeated in constructing the knot array.", + "KnotSpec": "The description of the knot type. This is for information only.", + "Knots": "The list of distinct knots used to define the B-spline basis functions.", + "UpperIndexOnKnots": "The upper index on the knot arrays; the lower index is 1. SIZEOF(Knots)" + }, + "description": "The IfcBSplineCurveWithKnots is a spline curve parameterized by spline functions for which the knot values are explicitly given.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcbsplinecurvewithknots.htm" + }, + "IfcBSplineSurface": { + "attributes": { + "ControlPoints": "Array (two-dimensional) of control points defining surface geometry. This array is constructed from the control points list. IfcMakeArrayOfArray(ControlPointsList, 0,UUpper,0,VUpper)", + "ControlPointsList": "This is a list of lists of control points.", + "SelfIntersect": "Flag to indicate whether, or not, surface is self-intersecting; this is for information only.", + "SurfaceForm": "Indicator of special surface types.", + "UClosed": "Indication of whether the surface is closed in the _u_ direction; this is for information only.", + "UDegree": "Algebraic degree of basis functions in _u_.", + "UUpper": "Upper index on control points in _u_ direction. SIZEOF(ControlPointsList) - 1", + "VClosed": "Indication of whether the surface is closed in the _v_ direction; this is for information only.", + "VDegree": "Algebraic degree of basis functions in _v_.", + "VUpper": "Upper index on control points in _v_ direction. SIZEOF(ControlPointsList[1]) - 1" + }, + "description": "The IfcBSplineSurface is a general form of rational or polynomial parametric surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcbsplinesurface.htm" + }, + "IfcBSplineSurfaceWithKnots": { + "attributes": { + "KnotSpec": "The description of the knot type.", + "KnotUUpper": "The number of distinct knots in the _u_ parameter direction. SIZEOF(UKnots)", + "KnotVUpper": "The number of distinct knots in the _v_ parameter direction. SIZEOF(VKnots)", + "UKnots": "The list of the distinct knots in the _u_ parameter direction.", + "UMultiplicities": "The multiplicities of the knots in the _u_ parameter direction.", + "VKnots": "The list of the distinct knots in the _v_ parameter direction.", + "VMultiplicities": "The multiplicities of the knots in the _v_ parameter direction." + }, + "description": "The IfcBSplineSurfaceWithKnots is a general form of rational or polynomial parametric surface in which the knot values are explicitly given.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcbsplinesurfacewithknots.htm" + }, + "IfcBeam": { + "attributes": { + "PredefinedType": "Predefined generic type for a beam that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcBeamType_ is assigned, providing its own _IfcBeamType.PredefinedType_." + }, + "description": "An IfcBeam is a horizontal, or nearly horizontal, structural member that is capable of withstanding load primarily by resisting bending. It represents such a member from an architectural point of view. It is not required to be load bearing.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbeam.htm" + }, + "IfcBeamStandardCase": { + "description": "The standard beam, IfcBeamStandardCase, defines a beam with certain constraints for the provision of material usage, parameters and with certain constraints for the geometric representation. The IfcBeamStandardCase handles all cases of beams, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbeamstandardcase.htm" + }, + "IfcBeamType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a beam element from which the type required may be set." + }, + "description": "The element type IfcBeamType defines commonly shared information for occurrences of beams. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbeamtype.htm" + }, + "IfcBlobTexture": { + "attributes": { + "RasterCode": "Blob, given as a single binary, to capture the texture within one popular file (compression) format. The file format is provided by the _RasterFormat_ attribute.", + "RasterFormat": "The format of the _RasterCode_ often using a compression." + }, + "description": "An IfcBlobTexture provides a 2-dimensional distribution of the lighting parameters of a surface onto which it is mapped. The texture itself is given as a single binary blob, representing the content of a pixel format file. The file format of the pixel file is given by the RasterFormat attribute and allowable formats are guided by where rule SupportedRasterFormat.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcblobtexture.htm" + }, + "IfcBlock": { + "attributes": { + "XLength": "The size of the block along the placement X axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[1]_.", + "YLength": "The size of the block along the placement Y axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[2]_.", + "ZLength": "The size of the block along the placement Z axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[3]_." + }, + "description": "The IfcBlock is a Construction Solid Geometry (CSG) 3D primitive. It is defined by a position and a positve distance along the three orthogonal axes. The inherited Position attribute has the IfcAxisPlacement3D type and provides:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcblock.htm" + }, + "IfcBoiler": { + "attributes": { + "PredefinedType": "" + }, + "description": "A boiler is a closed, pressure-rated vessel in which water or other fluid is heated using an energy source such as natural gas, heating oil, or electricity. The fluid in the vessel is then circulated out of the boiler for use in various processes or heating applications.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcboiler.htm" + }, + "IfcBoilerType": { + "attributes": { + "PredefinedType": "Defines types of boilers." + }, + "description": "The energy conversion device type IfcBoilerType defines commonly shared information for occurrences of boilers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcboilertype.htm" + }, + "IfcBooleanClippingResult": { + "description": "A clipping result is defined as a special subtype of the general IfcBooleanResult. It constrains the operands and the operator of the Boolean result.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcbooleanclippingresult.htm" + }, + "IfcBooleanResult": { + "attributes": { + "Dim": "The space dimensionality of this entity. It is identical with the space dimensionality of the first operand. A where rule ensures that both operands have the same space dimensionality. FirstOperand.Dim", + "FirstOperand": "The first operand to be operated upon by the Boolean operation.", + "Operator": "The Boolean operator used in the operation to create the result.", + "SecondOperand": "The second operand specified for the operation." + }, + "description": "The IfcBooleanResult is the result of applying a Boolean operation to two operands being solids.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcbooleanresult.htm" + }, + "IfcBoundaryCondition": { + "attributes": { + "Name": "Optionally defines a name for this boundary condition." + }, + "description": "The abstract entity IfcBoundaryCondition is the supertype of all boundary conditions that can be applied to structural connection definitions, either directly for the connection (e.g. the joint) or for the relation between a structural member and the connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcboundarycondition.htm" + }, + "IfcBoundaryCurve": { + "description": "An IfcBoundaryCurve defines a curve acting as the boundary of a surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcboundarycurve.htm" + }, + "IfcBoundaryEdgeCondition": { + "attributes": { + "RotationalStiffnessByLengthX": "Rotational stiffness value about the x-axis of the coordinate system defined by the instance which uses this resource object.", + "RotationalStiffnessByLengthY": "Rotational stiffness value about the y-axis of the coordinate system defined by the instance which uses this resource object.", + "RotationalStiffnessByLengthZ": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessByLengthX": "Translational stiffness value in x-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessByLengthY": "Translational stiffness value in y-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessByLengthZ": "Translational stiffness value in z-direction of the coordinate system defined by the instance which uses this resource object." + }, + "description": "Describes linearly elastic support conditions or connection conditions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcboundaryedgecondition.htm" + }, + "IfcBoundaryFaceCondition": { + "attributes": { + "TranslationalStiffnessByAreaX": "Translational stiffness value in x-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessByAreaY": "Translational stiffness value in y-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessByAreaZ": "Translational stiffness value in z-direction of the coordinate system defined by the instance which uses this resource object." + }, + "description": "Describes linearly elastic support conditions or connection conditions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcboundaryfacecondition.htm" + }, + "IfcBoundaryNodeCondition": { + "attributes": { + "RotationalStiffnessX": "Rotational stiffness value about the x-axis of the coordinate system defined by the instance which uses this resource object.", + "RotationalStiffnessY": "Rotational stiffness value about the y-axis of the coordinate system defined by the instance which uses this resource object.", + "RotationalStiffnessZ": "Rotational stiffness value about the z-axis of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessX": "Translational stiffness value in x-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessY": "Translational stiffness value in y-direction of the coordinate system defined by the instance which uses this resource object.", + "TranslationalStiffnessZ": "Translational stiffness value in z-direction of the coordinate system defined by the instance which uses this resource object." + }, + "description": "Describes linearly elastic support conditions or connection conditions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcboundarynodecondition.htm" + }, + "IfcBoundaryNodeConditionWarping": { + "attributes": { + "WarpingStiffness": "Defines the warping stiffness value." + }, + "description": "Describes linearly elastic support conditions or connection conditions, including linearly elastic warping restraints.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcboundarynodeconditionwarping.htm" + }, + "IfcBoundedCurve": { + "description": "An IfcBoundedCurve is a curve of finite length.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcboundedcurve.htm" + }, + "IfcBoundedSurface": { + "description": "An IfcBoundedSurface is a surface of finite area.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcboundedsurface.htm" + }, + "IfcBoundingBox": { + "attributes": { + "Corner": "Location of the bottom left corner (having the minimum values).", + "Dim": "The space dimensionality of this class, it is always 3. 3", + "XDim": "Length attribute (measured along the edge parallel to the X Axis)", + "YDim": "Width attribute (measured along the edge parallel to the Y Axis)", + "ZDim": "Height attribute (measured along the edge parallel to the Z Axis)." + }, + "description": "The IfcBoundingBox defines an orthogonal box oriented parallel to the axes of the object coordinate system in which it is defined. It is defined by a Corner being a three-dimensional Cartesian point and three length measures defining the X, Y and Z parameters of the box in the direction of the positive axes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcboundingbox.htm" + }, + "IfcBoxedHalfSpace": { + "attributes": { + "Enclosure": "The box which bounds the resulting solid of the Boolean operation involving the half space solid for computational purposes only." + }, + "description": "The IfcBoxedHalfSpace is used (as its supertype IfcHalfSpaceSolid) only within Boolean operations. It divides the domain into exactly two subsets, where the domain in question is that of the attribute Enclosure.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcboxedhalfspace.htm" + }, + "IfcBuilding": { + "attributes": { + "BuildingAddress": "Address given to the building for postal purposes.", + "ElevationOfRefHeight": "Elevation above sea level of the reference height used for all storey elevation measures, equals to height 0.0. It is usually the ground floor level.", + "ElevationOfTerrain": "Elevation above the minimal terrain level around the foot print of the building, given in elevation above sea level." + }, + "description": "A building represents a structure that provides shelter for its occupants or contents and stands in one place. The building is also used to provide a basic element within the spatial structure hierarchy for the components of a building project (together with site, storey, and space).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcbuilding.htm" + }, + "IfcBuildingElement": { + "description": "The building element comprises all elements that are primarily part of the construction of a building, i.e., its structural and space separating system. Building elements are all physically existent and tangible things", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcbuildingelement.htm" + }, + "IfcBuildingElementPart": { + "attributes": { + "PredefinedType": "Subtype of building element part" + }, + "description": "IfcBuildingElementPart represents major components as subordinate parts of a building element. Typical usage examples include precast concrete sandwich walls, where the layers may have different geometry representations. In this case the layered material representation does not sufficiently describe the element. Each layer is represented by an own instance of the IfcBuildingElementPart with its own geometry description.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcbuildingelementpart.htm" + }, + "IfcBuildingElementPartType": { + "attributes": { + "PredefinedType": "Subtype of building element part" + }, + "description": "The building element part type defines lists of commonly shared property set definitions and representation maps of parts of a building element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcbuildingelementparttype.htm" + }, + "IfcBuildingElementProxy": { + "attributes": { + "PredefinedType": "Predefined generic type for a building element proxy that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcBuildingElementProxyType_ is assigned, providing its own _IfcBuildingElementProxyType.PredefinedType_." + }, + "description": "The IfcBuildingElementProxy is a proxy definition that provides the same functionality as subtypes of IfcBuildingElement, but without having a predefined meaning of the special type of building element, it represents.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbuildingelementproxy.htm" + }, + "IfcBuildingElementProxyType": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of an building element proxy. There may be property set definitions available for each predefined or user defined type." + }, + "description": "IfcBuildingElementProxyType defines a list of commonly shared property set definitions of a building element proxy and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbuildingelementproxytype.htm" + }, + "IfcBuildingElementType": { + "description": "The IfcBuildingElementType provides the type information for IfcBuildingElement occurrences.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcbuildingelementtype.htm" + }, + "IfcBuildingStorey": { + "attributes": { + "Elevation": "Elevation of the base of this storey, relative to the 0,00 internal reference height of the building. The 0.00 level is given by the absolute above sea level height by the _ElevationOfRefHeight_ attribute given at _IfcBuilding_. > NOTE If the geometric data is provided (_ObjectPlacement_ is specified), the _Elevation_ value shall either not be included, or be equal to the local placement Z value." + }, + "description": "The building storey has an elevation and typically represents a (nearly) horizontal aggregation of spaces that are vertically bound.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcbuildingstorey.htm" + }, + "IfcBuildingSystem": { + "attributes": { + "LongName": "Long name for a building system, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a building system, and the _LongName_ refers to a descriptive name.", + "PredefinedType": "Predefined types of distribution systems." + }, + "description": "A building system is a group by which building elements are grouped according to a common function within the building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcbuildingsystem.htm" + }, + "IfcBurner": { + "attributes": { + "PredefinedType": "" + }, + "description": "A burner is a device that converts fuel into heat through combustion. It includes gas, oil, and wood burners.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcburner.htm" + }, + "IfcBurnerType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The energy conversion device type IfcBurnerType defines commonly shared information for occurrences of burners. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcburnertype.htm" + }, + "IfcCShapeProfileDef": { + "attributes": { + "Depth": "Profile depth, see illustration above (= h).", + "Girth": "Lengths of girth, see illustration above (= c).", + "InternalFilletRadius": "Internal fillet radius according the above illustration (= r1).", + "WallThickness": "Constant wall thickness of profile (= ts).", + "Width": "Profile width, see illustration above (= b)." + }, + "description": "IfcCShapeProfileDef defines a section profile that provides the defining parameters of a C-shaped section to be used by the swept area solid. This section is typically produced by cold forming steel. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profile's centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifccshapeprofiledef.htm" + }, + "IfcCableCarrierFitting": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable carrier fitting from which the type required may be set." + }, + "description": "A cable carrier fitting is a fitting that is placed at junction or transition in a cable carrier system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablecarrierfitting.htm" + }, + "IfcCableCarrierFittingType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable carrier fitting from which the type required may be set." + }, + "description": "The flow fitting type IfcCableCarrierFittingType defines commonly shared information for occurrences of cable carrier fittings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablecarrierfittingtype.htm" + }, + "IfcCableCarrierSegment": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable carrier segment from which the type required may be set." + }, + "description": "A cable carrier segment is a flow segment that is specifically used to carry and support cabling.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablecarriersegment.htm" + }, + "IfcCableCarrierSegmentType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable carrier segment from which the type required may be set." + }, + "description": "The flow segment type IfcCableCarrierSegmentType defines commonly shared information for occurrences of cable carrier segments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablecarriersegmenttype.htm" + }, + "IfcCableFitting": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable fitting from which the type required may be set." + }, + "description": "A cable fitting is a fitting that is placed at a junction, transition or termination in a cable system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablefitting.htm" + }, + "IfcCableFittingType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable fitting from which the type required may be set." + }, + "description": "The flow fitting type IfcCableFittingType defines commonly shared information for occurrences of cable fittings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablefittingtype.htm" + }, + "IfcCableSegment": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable segment from which the type required may be set." + }, + "description": "A cable segment is a flow segment used to carry electrical power, data, or telecommunications signals.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablesegment.htm" + }, + "IfcCableSegmentType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of cable segment from which the type required may be set." + }, + "description": "The flow segment type IfcCableSegmentType defines commonly shared information for occurrences of cable segments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifccablesegmenttype.htm" + }, + "IfcCartesianPoint": { + "attributes": { + "Coordinates": "The first, second, and third coordinate of the point location. If placed in a two or three dimensional rectangular Cartesian coordinate system, Coordinates[1] is the X coordinate, Coordinates[2] is the Y coordinate, and Coordinates[3] is the Z coordinate.", + "Dim": "The space dimensionality of this class, determined by the number of coordinates in the List of Coordinates. HIINDEX(Coordinates)" + }, + "description": "An IfcCartesianPoint defines a point by coordinates in an orthogonal, right-handed Cartesian coordinate system. For the purpose of this specification only two and three dimensional Cartesian points are used.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesianpoint.htm" + }, + "IfcCartesianPointList": { + "attributes": { + "Dim": "The space dimensionality of this class, either 2 or 3, depending on the sub type. IfcPointListDim(SELF)" + }, + "description": "The IfcCartesianPointList is the abstract supertype of list of points.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifccartesianpointlist.htm" + }, + "IfcCartesianPointList2D": { + "attributes": { + "CoordList": "Two-dimensional list of Cartesian points provided by two coordinates." + }, + "description": "The IfcCartesianPointList2D defines an ordered collection of two-dimentional Cartesian points. Each Cartesian point is provided as an two-dimensional point by a fixed list of two coordinates. The attribute CoordList is a two-dimensional list, where", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifccartesianpointlist2d.htm" + }, + "IfcCartesianPointList3D": { + "attributes": { + "CoordList": "Two-dimensional list of Cartesian points provided by three coordinates." + }, + "description": "The IfcCartesianPointList3D defines an ordered collection of three-dimentional Cartesian points. Each Cartesian point is provided as an three-dimensional point by a fixed list of three coordinates. The attribute CoordList is a two-dimensional list, where", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifccartesianpointlist3d.htm" + }, + "IfcCartesianTransformationOperator": { + "attributes": { + "Axis1": "The direction used to determine U[1], the derived X axis direction.", + "Axis2": "The direction used to determine U[2], the derived Y axis direction.", + "Dim": "The space dimensionality of this class, determined by the space dimensionality of the local origin. LocalOrigin.Dim", + "LocalOrigin": "The required translation, specified as a cartesian point. The actual translation included in the transformation is from the geometric origin to the local origin.", + "Scale": "The scaling value specified for the transformation.", + "Scl": "The derived scale S of the transformation, equal to scale if that exists, or 1.0 otherwise. NVL(Scale, 1.0)" + }, + "description": "An IfcCartesianTransformationOperator defines an abstract supertype of different kinds of geometric transformations.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesiantransformationoperator.htm" + }, + "IfcCartesianTransformationOperator2D": { + "attributes": { + "U": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis1 and Axis2 in that order. IfcBaseAxis(2,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,?)" + }, + "description": "An IfcCartesianTransformationOperator2D defines a geometric transformation in two-dimensional space.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesiantransformationoperator2d.htm" + }, + "IfcCartesianTransformationOperator2DnonUniform": { + "attributes": { + "Scale2": "The scaling value specified for the transformation along the axis 2. This is normally the y scale factor.", + "Scl2": "The derived scale S(2) of the transformation along the axis 2 (normally the y axis), equal to Scale2 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale2, SELF\\IfcCartesianTransformationOperator.Scl)" + }, + "description": "A Cartesian transformation operator 2d non uniform defines a geometric transformation in two-dimensional space composed of translation, rotation, mirroring and non uniform scaling. Non uniform scaling is given by two different scaling factors:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesiantransformationoperator2dnonuniform.htm" + }, + "IfcCartesianTransformationOperator3D": { + "attributes": { + "Axis3": "The exact direction of U[3], the derived Z axis direction.", + "U": "The list of mutually orthogonal, normalized vectors defining the transformation matrix T. They are derived from the explicit attributes Axis3, Axis1, and Axis2 in that order. IfcBaseAxis(3,SELF\\IfcCartesianTransformationOperator.Axis1, SELF\\IfcCartesianTransformationOperator.Axis2,Axis3)" + }, + "description": "An IfcCartesianTransformationOperator defines a geometric transformation in three-dimensional space.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesiantransformationoperator3d.htm" + }, + "IfcCartesianTransformationOperator3DnonUniform": { + "attributes": { + "Scale2": "The scaling value specified for the transformation along the axis 2. This is normally the y scale factor.", + "Scale3": "The scaling value specified for the transformation along the axis 3. This is normally the z scale factor.", + "Scl2": "The derived scale S(2) of the transformation along the axis 2 (normally the y axis), equal to Scale2 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale2, SELF\\IfcCartesianTransformationOperator.Scl)", + "Scl3": "The derived scale S(3) of the transformation along the axis 3 (normally the z axis), equal to Scale3 if that exists, or equal to the derived Scl1 (normally the x axis scale factor) otherwise. NVL(Scale3, SELF\\IfcCartesianTransformationOperator.Scl)" + }, + "description": "A Cartesian transformation operator 3d non uniform defines a geometric transformation in three-dimensional space composed of translation, rotation, mirroring and non uniform scaling. Non uniform scaling is given by three different scaling factors:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccartesiantransformationoperator3dnonuniform.htm" + }, + "IfcCenterLineProfileDef": { + "attributes": { + "Thickness": "Constant thickness applied along the center line." + }, + "description": "The profile IfcCenterLineProfileDef defines an arbitrary two-dimensional open, not self intersecting profile for the use within the swept solid geometry. It is given by an area defined by applying a constant thickness to a centerline, generating an area from which the solid can be constructed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifccenterlineprofiledef.htm" + }, + "IfcChiller": { + "attributes": { + "PredefinedType": "" + }, + "description": "A chiller is a device used to remove heat from a liquid via a vapor-compression or absorption refrigeration cycle to cool a fluid, typically water or a mixture of water and glycol. The chilled fluid is then used to cool and dehumidify air in a building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcchiller.htm" + }, + "IfcChillerType": { + "attributes": { + "PredefinedType": "Defines the typical types of chillers (e.g., air-cooled, water-cooled, etc.)." + }, + "description": "The energy conversion device type IfcChillerType defines commonly shared information for occurrences of chillers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcchillertype.htm" + }, + "IfcChimney": { + "attributes": { + "PredefinedType": "Predefined generic type for a chimney that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcChimneyType_ is assigned, providing its own _IfcChimneyType.PredefinedType_." + }, + "description": "Chimneys are typically vertical, or as near as vertical, parts of the construction of a building and part of the building fabric. Often constructed by pre-cast or insitu concrete, today seldom by bricks.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcchimney.htm" + }, + "IfcChimneyType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a chimney element from which the type required may be set." + }, + "description": "The building element type IfcChimneyType defines commonly shared information for occurrences of chimneys. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcchimneytype.htm" + }, + "IfcCircle": { + "attributes": { + "Radius": "The radius of the circle, which shall be greater than zero." + }, + "description": "An IfcCircle is a curve consisting of a set of points having equal distance from the center.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccircle.htm" + }, + "IfcCircleHollowProfileDef": { + "attributes": { + "WallThickness": "Thickness of the material, it is the difference between the outer and inner radius." + }, + "description": "IfcCircleHollowProfileDef defines a section profile that provides the defining parameters of a circular hollow section (tube) to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration.The centre of the position coordinate system is in the profile's centre of the bounding box (for symmetric profiles identical with the centre of gravity).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifccirclehollowprofiledef.htm" + }, + "IfcCircleProfileDef": { + "attributes": { + "Radius": "The radius of the circle." + }, + "description": "IfcCircleProfileDef defines a circle as the profile definition used by the swept surface geometry or by the swept area solid. It is given by its Radius attribute and placed within the 2D position coordinate system, established by the Position attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifccircleprofiledef.htm" + }, + "IfcCivilElement": { + "description": "An IfcCivilElement is a generalization of all elements within a civil engineering works. It includes in particular all occurrences of typical linear construction works, such as road segments, bridge segments, pavements, etc. Depending on the context of the construction project, included building work, such as buildings or factories, are represented as a collection of IfcBuildingElement's, distribution systems, such as piping or drainage, are represented as a collection of IfcDistributionElement's, and other geographic elements, such as trees, light posts, traffic signs etc. are represented as IfcGeographicElement's.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifccivilelement.htm" + }, + "IfcCivilElementType": { + "description": "An IfcCivilElementType is used to define an element specification of an element used within civil engineering works. Civil element types include for different types of element that may be used to represent information for construction works external to a building. IfcCivilElementType's may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifccivilelementtype.htm" + }, + "IfcClassification": { + "attributes": { + "ClassificationForObjects": "The classification with which objects are associated.", + "Description": "Additional description provided for the classification.", + "Edition": "The edition or version of the classification system from which the classification notation is derived. > NOTE the version labeling system is specific to the classification system.", + "EditionDate": "The date on which the edition of the classification used became valid. > NOTE The indication of edition may be sufficient to identify the classification source uniquely but the edition date is provided as an optional attribute to enable more precise identification where required.", + "HasReferences": "The classification references to which the classification applies. It can either be the final classification notation, or an intermediate classification item.", + "Location": "Resource identifier or locator, provided as URI, URN or URL, of the classification.", + "Name": "The name or label by which the classification used is normally known. > NOTE Examples of names include CI/SfB, Masterformat, BSAB, Uniclass, STABU, DIN276, DIN277 etc.", + "ReferenceTokens": "The delimiter tokens that are used to mark the boundaries of individual facets (substrings) in a classification reference. This typically applies then the _IfcClassification_ is used in conjuction with _IfcClassificationReference_'s. If only one _ReferenceToken_ is provided, it applies to all boundaries of individual facets, if more than one _ReferenceToken_ are provided, the first token applies to the first boundary, the second token to the second boundary, and the n^th^ token to the n^th^ and any additional boundary. > NOTE Tokens are typically recommended within the classification itself and each token will have a particular role. > EXAMPLE 1 To indicate that the facet delimiter used for DIN277-2 reference key \"2.1\" (\"Office rooms\") is \".\", a single _ReferenceToken_ ['.'] is provided. To indicate that the facet delimiter used for Omniclass Table 13 (space by function) reference key \"13-15 11 34 11\" (\"Office\") are \"-\" and \" \", two _ReferenceToken_'s ['-', ' '] are provided. > EXAMPLE 2 The use of _ReferenceTokens_ can also be extended to include masks. The use need to be agreed in view definitions or implementer agreements that stipulates a \"mask syntax\" that should be used.", + "Source": "Source (or publisher) for this classification. > NOTE that the source of the classification means the person or organization that was the original author or the person or organization currently acting as the publisher." + }, + "description": "An IfcClassification is used for the arrangement of objects into a class or category according to a common purpose or their possession of common characteristics. A classification in the sense of IfcClassification is taxonomy, or taxonomic scheme, arranged in a hierarchical structure. A category of objects relates to other categories in a generalization-specialization relationship. Therefore the classification items in an classification are organized in a tree structure.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcclassification.htm" + }, + "IfcClassificationReference": { + "attributes": { + "ClassificationRefForObjects": "The classification reference with which objects are associated.", + "Description": "Description of the classification reference for informational purposes.", + "HasReferences": "The parent classification references to which this child classification reference applies. It can either be the final classification item leaf node, or an intermediate classification item.", + "ReferencedSource": "The classification system or source that is referenced.", + "Sort": "Optional identifier to sort the set of classification references within the referenced source (either a classification facet of higher level, or the classification system itself)." + }, + "description": "An IfcClassificationReference is a reference into a classification system or source (see IfcClassification) for a specific classification key (or notation).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcclassificationreference.htm" + }, + "IfcClosedShell": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcclosedshell.htm" + }, + "IfcCoil": { + "attributes": { + "PredefinedType": "" + }, + "description": "A coil is a device used to provide heat transfer between non-mixing media. A common example is a cooling coil, which utilizes a finned coil in which circulates chilled water, antifreeze, or refrigerant that is used to remove heat from air moving across the surface of the coil. A coil may be used either for heating or cooling purposes by placing a series of tubes (the coil) carrying a heating or cooling fluid into an airstream. The coil may be constructed from tubes bundled in a serpentine form or from finned tubes that give a extended heat transfer surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccoil.htm" + }, + "IfcCoilType": { + "attributes": { + "PredefinedType": "Defines typical types of coils (e.g., Cooling, Heating, etc.)" + }, + "description": "The energy conversion device type IfcCoilType defines commonly shared information for occurrences of coils. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccoiltype.htm" + }, + "IfcColourRgb": { + "attributes": { + "Blue": "The intensity of the blue colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual.", + "Green": "The intensity of the green colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual.", + "Red": "The intensity of the red colour component. > NOTE The colour component value is given within the range of 0..1, and not within the range of 0..255 as otherwise usual." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccolourrgb.htm" + }, + "IfcColourRgbList": { + "attributes": { + "ColourList": "List of colours defined by the red, green, blue components. All values are provided as a ratio of 0.0 \u2264 _value_ \u2264 1.0. When using 8bit for each colour channel, a value of 0.0 equals 0, a value of 1.0 equals 255, and values between are interpolated." + }, + "description": "The IfcColourRgbList defines an ordered collection of RGB colour values. Each colour value is a fixed list of three colour components (red, green, blue). The attribute ColourList is a two-dimensional list, where:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccolourrgblist.htm" + }, + "IfcColourSpecification": { + "attributes": { + "Name": "Optional name given to a particular colour specification in addition to the colour components (like the RGB values). > EXAMPLE Names of a industry colour classification, such as RAL." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccolourspecification.htm" + }, + "IfcColumn": { + "attributes": { + "PredefinedType": "Predefined generic type for a column that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcColumnType_ is assigned, providing its own _IfcColumnType.PredefinedType_." + }, + "description": " NOTE Consider a complex property for glazing properties. The _Name_ attribute of the _IfcComplexProperty_ could be _Pset_GlazingProperties_, and the UsageName attribute could be _OuterGlazingPane_." + }, + "description": "IfcComplexProperty is used to define complex properties to be handled completely within a property set. The included set of properties may be a mixed or consistent collection of IfcProperty subtypes. This enables the definition of a set of properties to be included as a single 'property' entry in an IfcPropertySet. The definition of such an IfcComplexProperty can be reused in many different IfcPropertySet's.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifccomplexproperty.htm" + }, + "IfcComplexPropertyTemplate": { + "attributes": { + "HasPropertyTemplates": "Reference to a set of property templates. It should only be provided, if the _PropertyType_ is set to COMPLEX.", + "TemplateType": "", + "UsageName": "" + }, + "description": "The IfcComplexPropertyTemplate defines the template for all complex properties, either the IfcComplexProperty's, or the IfcPhysicalComplexQuantity's. The individual complex property templates are interpreted according to their Name attribute and and optional UsageName attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifccomplexpropertytemplate.htm" + }, + "IfcCompositeCurve": { + "attributes": { + "ClosedCurve": "Indication whether the curve is closed or not; this is derived from the transition code of the last segment. Segments[NSegments].Transition <> Discontinuous", + "NSegments": "The number of component curves. SIZEOF(Segments)", + "Segments": "The component bounded curves, their transitions and senses. The transition attribute for the last segment defines the transition between the end of the last segment and the start of the first; this transition attribute may take the value discontinuous, which indicates an open curve.", + "SelfIntersect": "Indication of whether the curve intersects itself or not; this is for information only." + }, + "description": "An IfcCompositeCurve is a continuous curve composed of curve segments.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccompositecurve.htm" + }, + "IfcCompositeCurveOnSurface": { + "attributes": { + "BasisSurface": "The surface on which the composite curve is defined. IfcGetBasisSurface(SELF)" + }, + "description": "The IfcCompositeCurveOnSurface is a collection of segments, based on p-curves. i.e. a curve which lies on the basis of a surface and is defined in the parameter space of that surface. The p-curve segment is a special type of a composite curve segment and shall only be used to bound a surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccompositecurveonsurface.htm" + }, + "IfcCompositeCurveSegment": { + "attributes": { + "Dim": "The space dimensionality of this class, defined by the dimensionality of the first ParentCurve. ParentCurve.Dim", + "ParentCurve": "The bounded curve which defines the geometry of the segment.", + "SameSense": "An indicator of whether or not the sense of the segment agrees with, or opposes, that of the parent curve. If _SameSense_ is false, the point with highest parameter value is taken as the first point of the segment. > NOTE If the datatype of _ParentCurve_ is _IfcTrimmedCurve_, the value of _SameSense_ overrides the value of _IfcTrimmedCurve.SenseAgreement_", + "Transition": "The state of transition (i.e., geometric continuity from the last point of this segment to the first point of the next segment) in a composite curve.", + "UsingCurves": "The set of composite curves which use this composite curve segment as a segment. This set shall not be empty." + }, + "description": "An IfcCompositeCurveSegment is a bounded curve constructed for the sole purpose to be a segment within an IfcCompositeCurve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccompositecurvesegment.htm" + }, + "IfcCompositeProfileDef": { + "attributes": { + "Label": "The name by which the composition may be referred to. The actual meaning of the name has to be defined in the context of applications.", + "Profiles": "The profiles which are used to define the composite profile." + }, + "description": "The IfcCompositeProfileDef defines the profile by composition of other profiles. The composition is given by a set of at least two other profile definitions. Any profile definition (except for another composite profile) can be used to construct the composite.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifccompositeprofiledef.htm" + }, + "IfcCompressor": { + "attributes": { + "PredefinedType": "" + }, + "description": "A compressor is a device that compresses a fluid typically used in a refrigeration circuit.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccompressor.htm" + }, + "IfcCompressorType": { + "attributes": { + "PredefinedType": "Defines the type of compressor (e.g., hermetic, reciprocating, etc.)." + }, + "description": "The flow moving device type IfcCompressorType defines commonly shared information for occurrences of compressors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccompressortype.htm" + }, + "IfcCondenser": { + "attributes": { + "PredefinedType": "" + }, + "description": "A condenser is a device that is used to dissipate heat, typically by condensing a substance such as a refrigerant from its gaseous to its liquid state.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccondenser.htm" + }, + "IfcCondenserType": { + "attributes": { + "PredefinedType": "Defines the type of condenser." + }, + "description": "The energy conversion device type IfcCondenserType defines commonly shared information for occurrences of condensers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccondensertype.htm" + }, + "IfcConic": { + "attributes": { + "Position": "The location and orientation of the conic. Further details of the interpretation of this attribute are given for the individual subtypes.\"" + }, + "description": "An IfcConic is a parameterized planar curve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcconic.htm" + }, + "IfcConnectedFaceSet": { + "attributes": { + "CfsFaces": "The set of faces arcwise connected along common edges or vertices." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcconnectedfaceset.htm" + }, + "IfcConnectionCurveGeometry": { + "attributes": { + "CurveOnRelatedElement": "The bounded curve at which the connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "CurveOnRelatingElement": "The bounded curve at which the connected objects are aligned at the relating element, given in the LCS of the relating element." + }, + "description": "IfcConnectionCurveGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a curve or at an edge with curve geometry associated. It is envisioned as a control that applies to the element connection relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectioncurvegeometry.htm" + }, + "IfcConnectionGeometry": { + "description": "IfcConnectionGeometry is used to describe the geometric and topological constraints that facilitate the physical connection of two objects. It is envisioned as a control that applies to the element connection relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectiongeometry.htm" + }, + "IfcConnectionPointEccentricity": { + "attributes": { + "EccentricityInX": "Distance in x direction between the two points (or vertex points) engaged in the point connection.", + "EccentricityInY": "Distance in y direction between the two points (or vertex points) engaged in the point connection.", + "EccentricityInZ": "Distance in z direction between the two points (or vertex points) engaged in the point connection." + }, + "description": "IfcConnectionPointEccentricity is used to describe the geometric constraints that facilitate the physical connection of two objects at a point or vertex point with associated point coordinates. There is a physical distance, or eccentricity, etween the connection points of both object. The eccentricity can be either given by:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectionpointeccentricity.htm" + }, + "IfcConnectionPointGeometry": { + "attributes": { + "PointOnRelatedElement": "Point at which connected objects are aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "PointOnRelatingElement": "Point at which the connected object is aligned at the relating element, given in the LCS of the relating element." + }, + "description": "IfcConnectionPointGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a point (here IfcCartesianPoint) or at an vertex with point coordinates associated. It is envisioned as a control that applies to the element connection relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectionpointgeometry.htm" + }, + "IfcConnectionSurfaceGeometry": { + "attributes": { + "SurfaceOnRelatedElement": "Surface at which the relating element is aligned at the related element, given in the LCS of the related element. If the information is omitted, then the origin of the related element is used.", + "SurfaceOnRelatingElement": "Surface at which related object is aligned at the relating element, given in the LCS of the relating element." + }, + "description": "IfcConnectionSurfaceGeometry is used to describe the geometric constraints that facilitate the physical connection of two objects at a surface or at a face with surface geometry associated. It is envisioned as a control that applies to the element connection relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectionsurfacegeometry.htm" + }, + "IfcConnectionVolumeGeometry": { + "attributes": { + "VolumeOnRelatedElement": "Volume at which related object overlaps with the relating element, given in the LCS of the related element.", + "VolumeOnRelatingElement": "Volume at which related object overlaps with the relating element, given in the LCS of the relating element." + }, + "description": "IfcConnectionVolumeGeometry is used to describe the geometric constraints that facilitate the physical connection (or overlap) of two objects at a volume defined by a solid or closed shell. It is envisioned as a control that applies to the element connection or interference relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcconnectionvolumegeometry.htm" + }, + "IfcConstraint": { + "attributes": { + "ConstraintGrade": "Enumeration that qualifies the type of constraint.", + "ConstraintSource": "Any source material, such as a code or standard, from which the constraint originated.", + "CreatingActor": "Person and/or organization that has created the constraint.", + "CreationTime": "Time when information specifying the constraint instance was created.", + "Description": "A human-readable description that may apply additional information about a constraint.", + "HasExternalReferences": "Reference to an external references, e.g. library, classification, or document information, that are associated to the constraint.", + "Name": "A human-readable name to be used for the constraint.", + "PropertiesForConstraint": "Reference to the properties to which the constraint is applied.", + "UserDefinedGrade": "Allows for specification of user defined grade of the constraint beyond the enumeration values (hard, soft, advisory) provided by ConstraintGrade attribute of type _IfcConstraintEnum_. When a value is provided for attribute UserDefinedGrade in parallel the attribute ConstraintGrade shall have enumeration value USERDEFINED." + }, + "description": "An IfcConstraint is used to define a constraint or limiting value or boundary condition that may be applied to an object or to the value of a property.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstraintresource/lexical/ifcconstraint.htm" + }, + "IfcConstructionEquipmentResource": { + "attributes": { + "PredefinedType": "Defines types of construction equipment resources." + }, + "description": "IfcConstructionEquipmentResource is usage of construction equipment to assist in the performance of construction. Construction Equipment resources are wholly or partially consumed or occupied in the performance of construction.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionequipmentresource.htm" + }, + "IfcConstructionEquipmentResourceType": { + "attributes": { + "PredefinedType": "Defines types of construction equipment resources." + }, + "description": "The resource type IfcConstructionEquipmentType defines commonly shared information for occurrences of construction equipment resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionequipmentresourcetype.htm" + }, + "IfcConstructionMaterialResource": { + "attributes": { + "PredefinedType": "Defines types of construction material resources." + }, + "description": "IfcConstructionMaterialResource identifies a material resource type in a construction project.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionmaterialresource.htm" + }, + "IfcConstructionMaterialResourceType": { + "attributes": { + "PredefinedType": "Defines types of construction material resources." + }, + "description": "The resource type IfcConstructionMaterialType defines commonly shared information for occurrences of construction material resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionmaterialresourcetype.htm" + }, + "IfcConstructionProductResource": { + "attributes": { + "PredefinedType": "Defines types of construction product resources." + }, + "description": "IfcConstructionProductResource defines the role of a product that is consumed (wholly or partially), or occupied in the performance of construction.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionproductresource.htm" + }, + "IfcConstructionProductResourceType": { + "attributes": { + "PredefinedType": "Defines types of construction product resources." + }, + "description": "The resource type IfcConstructionProductType defines commonly shared information for occurrences of construction product resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionproductresourcetype.htm" + }, + "IfcConstructionResource": { + "attributes": { + "BaseCosts": "Indicates the unit costs for which accrued amounts should be calculated. Such unit costs may be split into _Name_ designations (for example, 'Standard', 'Overtime'), and may contain a hierarchy of cost values that apply at different dates (using _IfcCostValue.ApplicableDate_ and _IfcCostValue.FixedUntilDate_).", + "BaseQuantity": "Identifies the base quantity consumed of the resource relative to assignments. For crew, labour, subcontract, and equipment resources, this refers to _IfcQuantityTime_. For material resources, this refers to _IfcQuantityVolume_. For product resources, this refers to _IfcQuantityCount_.", + "Usage": "Indicates the work, usage, and times scheduled and completed. Some attributes on this object may have associated constraints or time series; see documentation of _IfcResourceTime_ for specific usage. If the resource is nested, then certain values may be calculated based on the component resources as indicated at _IfcResourceTime_." + }, + "description": "IfcConstructionResource is an abstract generalization of the different resources used in construction projects, mainly labour, material, equipment and product resources, plus subcontracted resources and aggregations such as a crew resource.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionresource.htm" + }, + "IfcConstructionResourceType": { + "attributes": { + "BaseCosts": "Indicates the unit costs and environmental impacts for which accrued amounts should be calculated. Such unit costs may be split into _Name_ designations (e.g. 'Standard', 'Overtime'), and may contain a hierarchy of cost values that apply at different dates (using _IfcCostValue.ApplicableDate_ and _IfcCostValue.FixedUntilDate_).", + "BaseQuantity": "Identifies the quantity for which the _BaseQuantityProduced_ applies. The _Name_ of the _IfcPhysicalQuantity_ identifies the quantity definition being measured, e.g. \"GrossVolume\". For production-based resources (e.g. carpentry labor), this value refers to quantities on _IfcProduct_(s) to which the assigned _IfcTask_ is assigned. For duration-based resources (e.g. safety inspector, fuel for equipment), this value refers to quantities that may be assigned to occurrences of the assigned _IfcTaskType_." + }, + "description": "IfcConstructionResourceType is an abstract generalization of the different resource types used in construction projects, mainly labor, material, equipment and product resource types, plus subcontracted resource types and aggregations such as a crew resource type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcconstructionresourcetype.htm" + }, + "IfcContext": { + "attributes": { + "Declares": "Reference to the _IfcRelDeclares_ relationship that assigns the uppermost entities of includes hierarchies to this context instance. > NOTE The spatial hiearchy is assigned to _IfcProject_ using the _IfcRelAggregates_ relationship. This is a single exception due to compatibility reasons with earlier releases.", + "IsDefinedBy": "Set of relationships to property set definitions attached to this context. Those statically or dynamically defined properties contain alphanumeric information content that further defines the context.", + "LongName": "Long name for the context as used for reference purposes.", + "ObjectType": "The object type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. > NOTE Subtypes of _IfcContext_ do not introduce a _PredefinedType_ attribute, therefore the usage of _ObjectType_ is not bound to the selection of USERDEFINED within the _PredefinedType_ enumaration.", + "Phase": "Current project phase, or life-cycle phase of this project. Applicable values have to be agreed upon by view definitions or implementer agreements.", + "RepresentationContexts": "Context of the representations used within the context. When the context is a project and it includes shape representations for its components, one or several geometric representation contexts need to be included that define e.g. the world coordinate system, the coordinate space dimensions, and/or the precision factor.", + "UnitsInContext": "Units globally assigned to measure types used within the context." + }, + "description": "IfcContext is the generalization of a project context in which objects, type objects, property sets, and properties are defined. The IfcProject as subtype of IfcContext provides the context for all information on a construction project, it may include one or several IfcProjectLibrary's as subtype of IfcContext to register the included libraries for the project. A library of products that is referenced is declared within the IfcProjectLibrary as the context of that library.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifccontext.htm" + }, + "IfcContextDependentUnit": { + "attributes": { + "HasExternalReference": "Reference to external information, e.g. library, classification, or document information, which is associated with the context dependent unit.", + "Name": "The word, or group of words, by which the context dependent unit is referred to." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifccontextdependentunit.htm" + }, + "IfcControl": { + "attributes": { + "Controls": "Reference to the relationship that associates the control to the object(s) being controlled.", + "Identification": "An identifying designation given to a control It is the identifier at the occurrence level." + }, + "description": "IfcControl is the abstract generalization of all concepts that control or constrain the utilization of products, processes, or resources in general. It can be seen as a regulation, cost schedule, request or order, or other requirements applied to a product, process or resource whose requirements and provisions must be fulfilled.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifccontrol.htm" + }, + "IfcController": { + "attributes": { + "PredefinedType": "" + }, + "description": "A controller is a device that monitors inputs and controls outputs within a building automation system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifccontroller.htm" + }, + "IfcControllerType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of controller from which the type required may be set." + }, + "description": "The distribution control element type IfcControllerType defines commonly shared information for occurrences of controllers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifccontrollertype.htm" + }, + "IfcConversionBasedUnit": { + "attributes": { + "ConversionFactor": "The physical quantity from which the converted unit is derived.", + "HasExternalReference": "Reference to external information, e.g. library, classification, or document information, which is associated with the conversion-based unit.", + "Name": "The word, or group of words, by which the conversion based unit is referred to." + }, + "description": "An IfcConversionBasedUnit is used to define a unit that has a conversion rate to a base unit. To identify some commonly used conversion based units, the standard designations (case insensitive) for the Name attribute are indicated in Table 4.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcconversionbasedunit.htm" + }, + "IfcConversionBasedUnitWithOffset": { + "attributes": { + "ConversionOffset": "A positive or negative offset to add after the inherited _ConversionFactor_ was applied." + }, + "description": "IfcConversionBasedUnitWithOffset is a unit which is converted from another unit by applying a conversion factor and an offset.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcconversionbasedunitwithoffset.htm" + }, + "IfcCooledBeam": { + "attributes": { + "PredefinedType": "" + }, + "description": "A cooled beam (or chilled beam) is a device typically used to cool air by circulating a fluid such as chilled water through exposed finned tubes above a space. Typically mounted overhead near or within a ceiling, the cooled beam uses convection to cool the space below it by acting as a heat sink for the naturally rising warm air of the space. Once cooled, the air naturally drops back to the floor where the cycle begins again.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccooledbeam.htm" + }, + "IfcCooledBeamType": { + "attributes": { + "PredefinedType": "Defines the type of cooled beam." + }, + "description": "The energy conversion device type IfcCooledBeamType defines commonly shared information for occurrences of cooled beams. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccooledbeamtype.htm" + }, + "IfcCoolingTower": { + "attributes": { + "PredefinedType": "" + }, + "description": "A cooling tower is a device which rejects heat to ambient air by circulating a fluid such as water through it to reduce its temperature by partial evaporation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccoolingtower.htm" + }, + "IfcCoolingTowerType": { + "attributes": { + "PredefinedType": "Defines the typical types of cooling towers (e.g., OpenTower, ClosedTower, CrossFlow, etc.)." + }, + "description": "The energy conversion device type IfcCoolingTowerType defines commonly shared information for occurrences of cooling towers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifccoolingtowertype.htm" + }, + "IfcCoordinateOperation": { + "attributes": { + "SourceCRS": "Source coordinate reference system for the operation.", + "TargetCRS": "Target coordinate reference system for the operation." + }, + "description": "The coordinate operation is an abstract supertype to handle any operation (transformation or conversion) between two coordinate reference systems. It is meant to provide expandability for future versions, since currently only the conversion of a local engineering coordinate system into a map coordinate reference system is dealt with by the subtype IfcMapConversion.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifccoordinateoperation.htm" + }, + "IfcCoordinateReferenceSystem": { + "attributes": { + "Description": "Informal description of this coordinate reference system.", + "GeodeticDatum": "Name by which this datum is identified. The geodetic datum is associated with the coordinate reference system and indicates the shape and size of the rotation ellipsoid and this ellipsoid's connection and orientation to the actual globe/earth. It needs to be provided, if the _Name_ identifier does not unambiguously define the geodetic datum as well.", + "HasCoordinateOperation": "Indicates conversion between coordinate systems. In particular it refers to an _IfcCoordinateOperation_ between this coordinate reference system, and another Geographic coordinate reference system.", + "Name": "Name by which the coordinate reference system is identified. > NOTE The name shall be taken from the list recognized by the European Petroleum Survey Group EPSG. It should then be qualified by the EPSG name space, for example as 'EPSG:5555'.", + "VerticalDatum": "Name by which the vertical datum is identified. The vertical datum is associated with the height axis of the coordinate reference system and indicates the reference plane and fundamental point defining the origin of a height system. It needs to be provided, if the _Name_ identifier does not unambiguously define the vertical datum as well and if the coordinate reference system is a 3D reference system." + }, + "description": "The IfcCoordinateReferenceSystem is a definition of a coordinate reference system by means of qualified identifiers only. The interpretation of the identifier is expected to be well-known to the receiving software.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifccoordinatereferencesystem.htm" + }, + "IfcCostItem": { + "attributes": { + "CostQuantities": "Component quantities of the same type for which the total quantity for the cost item is calculated as the sum.", + "CostValues": "Component costs for which the total cost for the cost item is calculated, and then multiplied by the total _CostQuantities_ if provided. If _CostQuantities_ is provided then values indicate unit costs, otherwise values indicate total costs. For calculation purposes, the cost values may be directly added unless they have qualifications. Cost values with qualifications (e.g. _IfcCostValue.ApplicableDate_, _IfcCostValue.FixedUntilDate_) should be excluded from such calculation if they do not apply.", + "PredefinedType": "Predefined generic type for a cost item that is specified in an enumeration. There may be a property set given specificly for the predefined types." + }, + "description": "An IfcCostItem describes a cost or financial value together with descriptive information that describes its context in a form that enables it to be used within a cost schedule. An IfcCostItem can be used to represent the cost of goods and services, the execution of works by a process, lifecycle cost and more.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/lexical/ifccostitem.htm" + }, + "IfcCostSchedule": { + "attributes": { + "PredefinedType": "Predefined generic type for a cost schedule that is specified in an enumeration. There may be a property set given specifically for the predefined types.", + "Status": "The current status of a cost schedule. Examples of status values that might be used for a cost schedule status include: * PLANNED * APPROVED * AGREED * ISSUED * STARTED", + "SubmittedOn": "The date and time on which the cost schedule was submitted.", + "UpdateDate": "The date and time that this cost schedule is updated; this allows tracking the schedule history." + }, + "description": "An IfcCostSchedule brings together instances of IfcCostItem either for the purpose of identifying purely cost information as in an estimate for constructions costs or for including cost information within another presentation form such as a work order.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/lexical/ifccostschedule.htm" + }, + "IfcCostValue": { + "description": "IfcCostValue is an amount of money or a value that affects an amount of money.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccostresource/lexical/ifccostvalue.htm" + }, + "IfcCovering": { + "attributes": { + "CoversElements": "Reference to the objectified relationship that handles the relationship of the covering to the covered element.", + "CoversSpaces": "Reference to the objectified relationship that handles the relationship of the covering to the covered space.", + "PredefinedType": "Predefined types to define the particular type of the covering. There may be property set definitions available for each predefined type. > NOTE The _PredefinedType_ shall only be used, if no _IfcCoveringType_ is assigned, providing its own _IfcCoveringType.PredefinedType_." + }, + "description": "A covering is an element which covers some part of another element and is fully dependent on that other element. The IfcCovering defines the occurrence of a covering type, that (if given) is expressed by the IfcCoveringType.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifccovering.htm" + }, + "IfcCoveringType": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of the covering. There may be property set definitions available for each predefined type." + }, + "description": "The element type IfcCoveringType defines commonly shared information for occurrences of coverings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifccoveringtype.htm" + }, + "IfcCrewResource": { + "attributes": { + "PredefinedType": "Defines types of crew resources." + }, + "description": "IfcCrewResource represents a collection of internal resources used in construction processes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifccrewresource.htm" + }, + "IfcCrewResourceType": { + "attributes": { + "PredefinedType": "Defines types of crew resources." + }, + "description": "The resource type IfcCrewResourceType defines commonly shared information for occurrences of crew resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifccrewresourcetype.htm" + }, + "IfcCsgPrimitive3D": { + "attributes": { + "Dim": "The space dimensionality of this geometric representation item, it is always 3. 3", + "Position": "The placement coordinate system to which the parameters of each individual CSG primitive apply." + }, + "description": "IfcCsgPrimitive3D is an abstract supertype of all three dimensional primitives used as either tree root item, or as Boolean results within a CSG solid model. All 3D CSG primitives are defined within a three-dimensional placement coordinate system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifccsgprimitive3d.htm" + }, + "IfcCsgSolid": { + "attributes": { + "TreeRootExpression": "Boolean expression of primitives and regularized operators describing the solid. The root of the tree of Boolean expressions is given explicitly as an _IfcBooleanResult_ entitiy or as a primitive (subtypes of _IfcCsgPrimitive3D_)." + }, + "description": "An IfcCsgSolid is the representation of a 3D shape using constructive solid geometry model. It is represented by a single 3D CSG primitive, or as a result of a Boolean operation. The operants of a Boolean operation can be Boolean operations themselves forming a CSG tree. The following volumes can be parts of the CSG tree:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifccsgsolid.htm" + }, + "IfcCurrencyRelationship": { + "attributes": { + "ExchangeRate": "The currently agreed ratio of the amount of a related monetary unit that is equivalent to a unit amount of the relating monetary unit in a currency relationship. For instance, in the case of a conversion from GBP to USD, the value of the exchange rate may be 1.486 (USD) : 1 (GBP).", + "RateDateTime": "The date and time at which an exchange rate applies.", + "RateSource": "The source from which an exchange rate is obtained.", + "RelatedMonetaryUnit": "The monetary unit to which an exchange results. For instance, in the case of a conversion from GBP to USD, the related monetary unit is USD.", + "RelatingMonetaryUnit": "The monetary unit from which an exchange is derived. For instance, in the case of a conversion from GBP to USD, the relating monetary unit is GBP." + }, + "description": "IfcCurrencyRelationship defines the rate of exchange that applies between two designated currencies at a particular time and as published by a particular source.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccostresource/lexical/ifccurrencyrelationship.htm" + }, + "IfcCurtainWall": { + "attributes": { + "PredefinedType": "Predefined generic type for a curtain wall that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcCurtainWallType_ is assigned, providing its own _IfcCurtainWallType.PredefinedType_." + }, + "description": "A curtain wall is an exterior wall of a building which is an assembly of components, hung from the edge of the floor/roof structure rather than bearing on a floor. Curtain wall is represented as a building element assembly and implemented as a subtype of IfcBuildingElement that uses an IfcRelAggregates relationship.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifccurtainwall.htm" + }, + "IfcCurtainWallType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a curtain wall element from which the type required may be set." + }, + "description": "The building element type IfcCurtainWallType defines commonly shared information for occurrences of curtain walls. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifccurtainwalltype.htm" + }, + "IfcCurve": { + "attributes": { + "Dim": "The space dimensionality of this abstract class, defined differently for all subtypes, i.e. for IfcLine, IfcConic and IfcBoundedCurve. IfcCurveDim(SELF)" + }, + "description": "An IfcCurve is a curve in two-dimensional or three-dimensional space. It includes definitions for bounded and unbounded curves.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccurve.htm" + }, + "IfcCurveBoundedPlane": { + "attributes": { + "BasisSurface": "The surface to be bound.", + "InnerBoundaries": "An optional set of inner boundaries. They shall not intersect each other or the outer boundary.", + "OuterBoundary": "The outer boundary of the surface." + }, + "description": "The IfcCurveBoundedPlane is a parametric planar surface with curved boundaries defined by one or more boundary curves. The bounded plane is defined to be the portion of the basis surface in the direction of N x T from any point on the boundary, where N is the surface normal and T the boundary curve tangent vector at this point. The region so defined shall be arcwise connected.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccurveboundedplane.htm" + }, + "IfcCurveBoundedSurface": { + "attributes": { + "BasisSurface": "The surface to be bounded.", + "Boundaries": "The outer boundary of the surface.", + "ImplicitOuter": "" + }, + "description": "The IfcCurveBoundedSurface is a parametric surface with boundaries defined by p-curves, that is, a curve which lies on the basis of a surface and is defined in the parameter space of that surface. The p-curve is a special type of a composite curve segment and shall only be used to bound a surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccurveboundedsurface.htm" + }, + "IfcCurveStyle": { + "attributes": { + "CurveColour": "The colour of the visible part of the curve. If not given, then the colour should be taken from the layer assignment with style, if that is not given either, then the default colour applies.", + "CurveFont": "A curve style font which is used to present a curve. It can either be a predefined curve font, or an explicitly defined curve font. Both may be scaled. If not given, then the curve font should be taken from the layer assignment with style, if that is not given either, then the default curve font applies.", + "CurveWidth": "A positive length measure in units of the presentation area for the width of a presented curve. If not given, then the style should be taken from the layer assignment with style, if that is not given either, then the default style applies.", + "ModelOrDraughting": "Indication whether the length measures provided for the presentation style are model based, or draughting based." + }, + "description": "An IfcCurveStyle provides the style table for presentation information assigned to geometric curves. The style is defined by a color, a font and a width. The IfcCurveStyle defines curve patterns as model patterns, that is, the distance between visible and invisible segments of curve patterns are given in model space dimensions (that have to be scaled using the target plot scale).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccurvestyle.htm" + }, + "IfcCurveStyleFont": { + "attributes": { + "Name": "Name that may be assigned with the curve font.", + "PatternList": "A list of curve font pattern entities, that contains the simple patterns used for drawing curves. The patterns are applied in the order they occur in the list." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccurvestylefont.htm" + }, + "IfcCurveStyleFontAndScaling": { + "attributes": { + "CurveFont": "The curve font to be scaled.", + "CurveFontScaling": "The scale factor.", + "Name": "Name that may be assigned with the scaling of a curve font." + }, + "description": "The IfcCurveStyleFontAndScaling allows for the reuse of the same curve style definition in several sizes. The definition of the CurveFontScale is the scaling of a base curve style pattern to be used as a new or derived curve style pattern.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccurvestylefontandscaling.htm" + }, + "IfcCurveStyleFontPattern": { + "attributes": { + "InvisibleSegmentLength": "The length of the invisible segment in the pattern definition.", + "VisibleSegmentLength": "The length of the visible segment in the pattern definition. > NOTE For a visible segment representing a point, the value 0. should be assigned." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifccurvestylefontpattern.htm" + }, + "IfcCylindricalSurface": { + "attributes": { + "Radius": "The radius of the cylindrical surface." + }, + "description": "The cylindrical surface is a surface unbounded in the direction of z. Bounded cylindrical surfaces are defined by using a subtype of IfcBoundedSurface with BasisSurface being a cylindrical surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifccylindricalsurface.htm" + }, + "IfcDamper": { + "attributes": { + "PredefinedType": "" + }, + "description": "A damper typically participates in an HVAC duct distribution system and is used to control or modulate the flow of air.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcdamper.htm" + }, + "IfcDamperType": { + "attributes": { + "PredefinedType": "Type of damper." + }, + "description": "The flow controller type IfcDamperType defines commonly shared information for occurrences of dampers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcdampertype.htm" + }, + "IfcDerivedProfileDef": { + "attributes": { + "Label": "The name by which the transformation may be referred to. The actual meaning of the name has to be defined in the context of applications.", + "Operator": "Transformation operator applied to the parent profile.", + "ParentProfile": "The parent profile provides the origin of the transformation." + }, + "description": "IfcDerivedProfileDef defines the profile by transformation from the parent profile. The transformation is given by a two dimensional transformation operator. Transformation includes translation, rotation, mirror and scaling. The latter can be uniform or non uniform. The derived profiles may be used to define swept surfaces, swept area solids or sectioned spines.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcderivedprofiledef.htm" + }, + "IfcDerivedUnit": { + "attributes": { + "Dimensions": "Dimensional exponents derived using the function IfcDerivedDimensionalExponents using (SELF) as the input value. IfcDeriveDimensionalExponents(Elements)", + "Elements": "The group of units and their exponents that define the derived unit.", + "UnitType": "Name of the derived unit chosen from an enumeration of derived unit types for use in IFC models.", + "UserDefinedType": "" + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcderivedunit.htm" + }, + "IfcDerivedUnitElement": { + "attributes": { + "Exponent": "The power that is applied to the unit attribute.", + "Unit": "The fixed quantity which is used as the mathematical factor." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcderivedunitelement.htm" + }, + "IfcDimensionalExponents": { + "attributes": { + "AmountOfSubstanceExponent": "The power of the amount of substance base quantity.", + "ElectricCurrentExponent": "The power of the electric current base quantity.", + "LengthExponent": "The power of the length base quantity.", + "LuminousIntensityExponent": "The power of the luminous intensity base quantity.", + "MassExponent": "The power of the mass base quantity.", + "ThermodynamicTemperatureExponent": "The power of the thermodynamic temperature base quantity.", + "TimeExponent": "The power of the time base quantity." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcdimensionalexponents.htm" + }, + "IfcDirection": { + "attributes": { + "Dim": "The space dimensionality of this class, defined by the number of real in the list of DirectionRatios. HIINDEX(DirectionRatios)", + "DirectionRatios": "The components in the direction of X axis (DirectionRatios[1]), of Y axis (DirectionRatios[2]), and of Z axis (DirectionRatios[3])" + }, + "description": "The IfcDirection provides a direction in two or three dimensional space depending on the number of DirectionRatio's provided. The IfcDirection does not imply a vector length, and the direction ratios does not have to be normalized.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcdirection.htm" + }, + "IfcDiscreteAccessory": { + "attributes": { + "PredefinedType": "Subtype of discrete accessory. If USERDEFINED, the type is further qualified by means of the inherited attribute _ObjectType_. Refer to _IfcDiscreteAccessoryType_ for a non-exclusive list of userdefined type designations which are applicable to _IfcDiscreteAccessory_ as well." + }, + "description": "A discrete accessory is a representation of different kinds of accessories included in or added to elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcdiscreteaccessory.htm" + }, + "IfcDiscreteAccessoryType": { + "attributes": { + "PredefinedType": "Subtype of discrete accessory" + }, + "description": "The element component type IfcDiscreteAccessoryType defines commonly shared information for occurrences of discrete accessorys. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcdiscreteaccessorytype.htm" + }, + "IfcDistributionChamberElement": { + "attributes": { + "PredefinedType": "" + }, + "description": "A distribution chamber element defines a place at which distribution systems and their constituent elements may be inspected or through which they may travel.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionchamberelement.htm" + }, + "IfcDistributionChamberElementType": { + "attributes": { + "PredefinedType": "Predefined types of distribution chambers." + }, + "description": "The distribution flow element type IfcDistributionChamberElementType defines commonly shared information for occurrences of distribution chamber elements. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionchamberelementtype.htm" + }, + "IfcDistributionCircuit": { + "description": "A distribution circuit is a partition of a distribution system that is conditionally switched such as an electrical circuit.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributioncircuit.htm" + }, + "IfcDistributionControlElement": { + "attributes": { + "AssignedToFlowElement": "Reference through the relationship object to related distribution flow elements." + }, + "description": "The distribution element IfcDistributionControlElement defines occurrence elements of a building automation control system that are used to impart control over elements of a distribution system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributioncontrolelement.htm" + }, + "IfcDistributionControlElementType": { + "description": "The element type IfcDistributionControlElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (the specific product information that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributioncontrolelementtype.htm" + }, + "IfcDistributionElement": { + "attributes": { + "HasPorts": "Reference to the element to port connection relationship. The relationship then refers to the port which is contained in this element." + }, + "description": "This IfcDistributionElement is a generalization of all elements that participate in a distribution system. Typical examples of IfcDistributionElement's are (among others):", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcdistributionelement.htm" + }, + "IfcDistributionElementType": { + "description": "The IfcDistributionElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcdistributionelementtype.htm" + }, + "IfcDistributionFlowElement": { + "attributes": { + "HasControlElements": "Reference to the relationship object that relates control elements." + }, + "description": "The distribution element IfcDistributionFlowElement defines occurrence elements of a distribution system that facilitate the distribution of energy or matter, such as air, water or power.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionflowelement.htm" + }, + "IfcDistributionFlowElementType": { + "description": "The element type IfcDistributionFlowElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (the specific product information that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionflowelementtype.htm" + }, + "IfcDistributionPort": { + "attributes": { + "FlowDirection": "Enumeration that identifies if this port is a Sink (inlet), a Source (outlet) or both a SinkAndSource.", + "PredefinedType": "", + "SystemType": "Enumeration that identifies the system type. If a system type is defined, the port may only be connected to other ports having the same system type." + }, + "description": "A distribution port is an inlet or outlet of a product through which a particular substance may flow.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionport.htm" + }, + "IfcDistributionSystem": { + "attributes": { + "LongName": "Long name for a distribution system, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a distribution system or branch circuit, and the _LongName_ refers to a descriptive name.", + "PredefinedType": "Predefined types of distribution systems." + }, + "description": "A distribution system is a network designed to receive, store, maintain, distribute, or control the flow of a distribution media. A common example is a heating hot water system that consists of a pump, a tank, and an interconnected piping system for distributing hot water to terminals.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcdistributionsystem.htm" + }, + "IfcDocumentInformation": { + "attributes": { + "Confidentiality": "The level of confidentiality of the document.", + "CreationTime": "Date and time stamp when the document was originally created.", + "Description": "Description of document and its content.", + "DocumentInfoForObjects": "The document information with which objects are associated.", + "DocumentOwner": "Information about the person and/or organization acknowledged as the 'owner' of this document. In some contexts, the document owner determines who has access to or editing right to the document.", + "Editors": "The persons and/or organizations who have created this document or contributed to it.", + "ElectronicFormat": "Describes the media type used in various internet protocols, also referred to as \"Content-type\", or \"MIME-type (Multipurpose Internet Mail Extension), of the document being referenced. It is composed of (at least) two parts, a type and a subtype. > NOTE The iana (Internet Assigned Numbers Authority) published the media types. > EXAMPLE 'image/png' denotes an image type of png (Portable Network Graphics) subtype, 'application/pdf' denotes an application specific type of pdf (Portable Document Format) subtype", + "HasDocumentReferences": "The document references to which the document applies", + "Identification": "Identifier that uniquely identifies a document.", + "IntendedUse": "Intended use for this document.", + "IsPointedTo": "An inverse relationship from the IfcDocumentInformationRelationship to the related documents./EPM-HTML>", + "IsPointer": "An inverse relationship from the IfcDocumentInformationRelationship to the relating document.", + "LastRevisionTime": "Date and time stamp when this document version was created.", + "Location": "Resource identifier or locator, provided as URI, URN or URL, of the document information for online references.", + "Name": "File name or document name assigned by owner.", + "Purpose": "Purpose for this document.", + "Revision": "Document revision designation.", + "Scope": "Scope for this document.", + "Status": "The current status of the document. Examples of status values that might be used for a document information status include: - DRAFT - FINAL DRAFT - FINAL - REVISION", + "ValidFrom": "Date when the document becomes valid.", + "ValidUntil": "Date until which the document remains valid." + }, + "description": "IfcDocumentInformation captures \"metadata\" of an external document. The actual content of the document is not defined in this specification; instead, it can be found following the Location attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcdocumentinformation.htm" + }, + "IfcDocumentInformationRelationship": { + "attributes": { + "RelatedDocuments": "The document that acts as the child, referenced or replacing document in a relationship.", + "RelatingDocument": "The document that acts as the parent, referencing or original document in a relationship.", + "RelationshipType": "Describes the type of relationship between documents. This could be sub-document, replacement etc. The interpretation has to be established in an application context." + }, + "description": "An IfcDocumentInformationRelationship is a relationship entity that enables a document to have the ability to reference other documents. It is used to describe relationships in which one document may reference one or more other sub documents or where a document is used as a replacement for another document (but where both the original and the replacing document need to be retained).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcdocumentinformationrelationship.htm" + }, + "IfcDocumentReference": { + "attributes": { + "Description": "Description of the document reference for informational purposes.", + "DocumentRefForObjects": "The document reference with which objects are associated.", + "ReferencedDocument": "The document that is referenced." + }, + "description": "An IfcDocumentReference is a reference to the location of a document. The reference is given by a system interpretable Location attribute (a URL string) where the document can be found, and an optional inherited internal reference Identification, which refers to a system interpretable position within the document. The optional inherited Name attribute is meant to have meaning for human readers. Optional document metadata can also be captured through reference to IfcDocumentInformation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcdocumentreference.htm" + }, + "IfcDoor": { + "attributes": { + "OperationType": "Type defining the general layout and operation of the door type in terms of the partitioning of panels and panel operations. > NOTE The _OperationType_ shall only be used, if no type object _IfcDoorType_ is assigned, providing its own _IfcDoorType.OperationType_.", + "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE The body of the door might be taller then the door opening (e.g. in cases where the door lining includes a casing). In these cases the _OverallHeight_ shall still be given as the door opening height, and not as the total height of the door lining.", + "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the ~~body of the~~ door opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the door is inserted. > NOTE The body of the door might be wider then the door opening (e.g. in cases where the door lining includes a casing). In these cases the _OverallWidth_ shall still be given as the door opening width, and not as the total width of the door lining.", + "PredefinedType": "Predefined generic type for a door that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcDoorType_ is assigned, providing its own _IfcDoorType.PredefinedType_.", + "UserDefinedOperationType": "Designator for the user defined operation type, shall only be provided, if the value of _OperationType_ is set to USERDEFINED." + }, + "description": "The door is a building element that is predominately used to provide controlled access for people and goods. It includes constructions with hinged, pivoted, sliding, and additionally revolving and folding operations. A door consists of a lining and one or several panels.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcdoor.htm" + }, + "IfcDoorLiningProperties": { + "attributes": { + "CasingDepth": "Depth of the casing (dimension in plane perpendicular to door leaf). If given it is applied equally to all four sides of the adjacent wall.", + "CasingThickness": "Thickness of the casing (dimension in plane of the door leaf). If given it is applied equally to all four sides of the adjacent wall.", + "LiningDepth": "Depth of the door lining, measured perpendicular to the plane of the door lining. If omitted (and with a given value to lining thickness) it indicates an adjustable depth (i.e. a depth that adjusts to the thickness of the wall into which the occurrence of this door style is inserted).", + "LiningOffset": "Offset (dimension in plane perpendicular to door leaf) of the door lining. The offset is given as distance to the x axis of the local placement.", + "LiningThickness": "Thickness of the door lining as explained in the figure above. If _LiningThickness_ value is 0. (zero) it denotes a door without a lining (all other lining parameters shall be set to NIL in this case). If the _LiningThickness_ is NIL it denotes that the value is not available.", + "LiningToPanelOffsetX": "Offset between the lining and the window panel measured along the x-axis of the local placement.", + "LiningToPanelOffsetY": "Offset between the lining and the door panel measured along the y-axis of the local placement.", + "ShapeAspectStyle": "Pointer to the shape aspect, if given. The shape aspect reflects the part of the door shape, which represents the door lining.", + "ThresholdDepth": "Depth (dimension in plane perpendicular to door leaf) of the door threshold. Only given if the door lining includes a threshold. If omitted (and with a given value to threshold thickness) it indicates an adjustable depth (i.e. a depth that adjusts to the thickness of the wall into which the occurrence of this door style is inserted).", + "ThresholdOffset": "Offset (dimension in plane perpendicular to door leaf) of the door threshold. The offset is given as distance to the x axis of the local placement. Only given if the door lining includes a threshold and the parameter is known.", + "ThresholdThickness": "Thickness of the door threshold as explained in the figure above. If _ThresholdThickness_ value is 0. (zero) it denotes a door without a threshold (_ThresholdDepth_ shall be set to NIL in this case). If the _ThresholdThickness_ is NIL it denotes that the information about a threshold is not available.", + "TransomOffset": "Offset of the transom (if given) which divides the door leaf from a glazing (or window) above. The offset is given from the bottom of the door opening.", + "TransomThickness": "Thickness (width in plane parallel to door leaf) of the transom (if provided - that is, if the _TransomOffset_ attribute is set), which divides the door leaf from a glazing (or window) above. If the _TransomThickness_ is set to zero (and the _TransomOffset_ set to a positive length), then the door is divided vertically into a leaf and transom window area without a physical frame." + }, + "description": "The door lining is the frame which enables the door leaf to be fixed in position. The door lining is used to hang the door leaf. The parameters of the door lining define the geometrically relevant parameter of the lining.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcdoorliningproperties.htm" + }, + "IfcDoorPanelProperties": { + "attributes": { + "PanelDepth": "Depth of the door panel, measured perpendicular to the plane of the door leaf.", + "PanelOperation": "The _PanelOperation_ defines the way of operation of that panel. The _PanelOperation_ of the door panel has to correspond with the _OperationType_ of the _IfcDoorStyle_ by which it is referenced.", + "PanelPosition": "Position of this panel within the door. The _PanelPosition_ of the door panel has to correspond with the _OperationType_ of the _IfcDoorStyle_ by which it is referenced.", + "PanelWidth": "Width of this panel, given as ratio relative to the total clear opening width of the door. If omited, it defaults to 1. A value has to be provided for all doors with _OperationType_'s at _IfcDoorStyle_ defining a door with more then one panel.", + "ShapeAspectStyle": "Pointer to the shape aspect, if given. The shape aspect reflects the part of the door shape, which represents the door panel." + }, + "description": "A door panel is normally a door leaf that opens to allow people or goods to pass. The parameters of the door panel define the geometrically relevant parameter of the panel,", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcdoorpanelproperties.htm" + }, + "IfcDoorStandardCase": { + "description": "The standard door, IfcDoorStandardCase, defines a door with certain constraints for the provision of operation types, opening directions, frame and lining parameters, and with certain constraints for the geometric representation. The IfcDoorStandardCase handles all cases of doors, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcdoorstandardcase.htm" + }, + "IfcDoorStyle": { + "attributes": { + "ConstructionType": "Type defining the basic construction and material type of the door.", + "OperationType": "Type defining the general layout and operation of the door style.", + "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value.", + "Sizeable": "The Boolean indicates, whether the attached _IfcMappedRepresentation_ (if given) can be sized (using scale factor of transformation), or not (FALSE). If not, the _IfcMappedRepresentation_ should be _IfcShapeRepresentation_ of the _IfcDoor_ (using _IfcMappedItem_ as the _Item_) with the scale factor = 1." + }, + "description": "Definition: The door style, IfcDoorStyle, defines a particular style of doors, which may be included into the spatial context of the building model through instances of IfcDoor. A door style defines the overall parameter of the door style and refers to the particular parameter of the lining and one (or several) panels through the IfcDoorLiningProperties and the IfcDoorPanelProperties.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcdoorstyle.htm" + }, + "IfcDoorType": { + "attributes": { + "OperationType": "Type defining the general layout and operation of the door type in terms of the partitioning of panels and panel operations.", + "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value. If not provided, no such information can be infered.", + "PredefinedType": "Identifies the predefined types of a door element from which the type required may be set.", + "UserDefinedOperationType": "Designator for the user defined operation type, shall only be provided, if the value of _OperationType_ is set to USERDEFINED." + }, + "description": "The element type IfcDoorType defines commonly shared information for occurrences of doors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcdoortype.htm" + }, + "IfcDraughtingPreDefinedColour": { + "description": "The draughting pre defined colour is a pre defined colour for the purpose to identify a colour by name. Allowable names are:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcdraughtingpredefinedcolour.htm" + }, + "IfcDraughtingPreDefinedCurveFont": { + "description": "The draughting predefined curve font type defines a selection of widely used curve fonts for draughting purposes by name.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcdraughtingpredefinedcurvefont.htm" + }, + "IfcDuctFitting": { + "attributes": { + "PredefinedType": "" + }, + "description": "A duct fitting is a junction or transition in a ducted flow distribution system or used to connect duct segments, resulting in changes in flow characteristics to the fluid such as direction and flow rate.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductfitting.htm" + }, + "IfcDuctFittingType": { + "attributes": { + "PredefinedType": "The type of duct fitting." + }, + "description": "The flow fitting type IfcDuctFittingType defines commonly shared information for occurrences of duct fittings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductfittingtype.htm" + }, + "IfcDuctSegment": { + "attributes": { + "PredefinedType": "" + }, + "description": "A duct segment is used to typically join two sections of duct network.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductsegment.htm" + }, + "IfcDuctSegmentType": { + "attributes": { + "PredefinedType": "The type of duct segment." + }, + "description": "The flow segment type IfcDuctSegmentType defines commonly shared information for occurrences of duct segments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductsegmenttype.htm" + }, + "IfcDuctSilencer": { + "attributes": { + "PredefinedType": "" + }, + "description": "A duct silencer is a device that is typically installed inside a duct distribution system for the purpose of reducing the noise levels from air movement, fan noise, etc. in the adjacent space or downstream of the duct silencer device.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductsilencer.htm" + }, + "IfcDuctSilencerType": { + "attributes": { + "PredefinedType": "The type of duct silencer." + }, + "description": "The flow treatment device type IfcDuctSilencerType defines commonly shared information for occurrences of duct silencers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcductsilencertype.htm" + }, + "IfcEdge": { + "attributes": { + "EdgeEnd": "End point (vertex) of the edge. The same vertex can be used for both EdgeStart and EdgeEnd.", + "EdgeStart": "Start point (vertex) of the edge." + }, + "description": "An IfcEdge defines two vertices being connected topologically. The geometric representation of the connection between the two vertices defaults to a straight line if no curve geometry is assigned using the subtype IfcEdgeCurve. The IfcEdge can therefore be used to exchange straight edges without an associated geometry provided by IfcLine or IfcPolyline thought IfcEdgeCurve.EdgeGeometry.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcedge.htm" + }, + "IfcEdgeCurve": { + "attributes": { + "EdgeGeometry": "The curve which defines the shape and spatial location of the edge. This curve may be unbounded and is implicitly trimmed by the vertices of the edge; this defines the edge domain. Multiple edges can reference the same curve.", + "SameSense": "This logical flag indicates whether (TRUE), or not (FALSE) the senses of the edge and the curve defining the edge geometry are the same. The sense of an edge is from the edge start vertex to the edge end vertex; the sense of a curve is in the direction of increasing parameter." + }, + "description": "An IfcEdgeCurve defines two vertices being connected topologically including the geometric representation of the connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcedgecurve.htm" + }, + "IfcEdgeLoop": { + "attributes": { + "EdgeList": "A list of oriented edge entities which are concatenated together to form this path.", + "Ne": "The number of elements in the edge list. SIZEOF(EdgeList)" + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcedgeloop.htm" + }, + "IfcElectricAppliance": { + "attributes": { + "PredefinedType": "" + }, + "description": "An electric appliance is a device intended for consumer usage that is powered by electricity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricappliance.htm" + }, + "IfcElectricApplianceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electrical appliance from which the type required may be set." + }, + "description": "The flow terminal type IfcElectricApplianceType defines commonly shared information for occurrences of electric appliances. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricappliancetype.htm" + }, + "IfcElectricDistributionBoard": { + "attributes": { + "PredefinedType": "" + }, + "description": "A distribution board is a flow controller in which instances of electrical devices are brought together at a single place for a particular purpose.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricdistributionboard.htm" + }, + "IfcElectricDistributionBoardType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electric distribution type from which the type required may be set." + }, + "description": "The flow controller type IfcElectricDistributionBoardType defines commonly shared information for occurrences of electric distribution boards. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricdistributionboardtype.htm" + }, + "IfcElectricFlowStorageDevice": { + "attributes": { + "PredefinedType": "" + }, + "description": "An electric flow storage device is a device in which electrical energy is stored and from which energy may be progressively released.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricflowstoragedevice.htm" + }, + "IfcElectricFlowStorageDeviceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electric flow storage devices from which the type required may be set." + }, + "description": "The flow storage device type IfcElectricFlowStorageDeviceType defines commonly shared information for occurrences of electric flow storage devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricflowstoragedevicetype.htm" + }, + "IfcElectricGenerator": { + "attributes": { + "PredefinedType": "" + }, + "description": "An electric generator is an engine that is a machine for converting mechanical energy into electrical energy.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricgenerator.htm" + }, + "IfcElectricGeneratorType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electric generators from which the type required may be set." + }, + "description": "The energy conversion device type IfcElectricGeneratorType defines commonly shared information for occurrences of electric generators. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricgeneratortype.htm" + }, + "IfcElectricMotor": { + "attributes": { + "PredefinedType": "" + }, + "description": "An electric motor is an engine that is a machine for converting electrical energy into mechanical energy.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricmotor.htm" + }, + "IfcElectricMotorType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electric motor from which the type required may be set." + }, + "description": "The energy conversion device type IfcElectricMotorType defines commonly shared information for occurrences of electric motors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectricmotortype.htm" + }, + "IfcElectricTimeControl": { + "attributes": { + "PredefinedType": "" + }, + "description": "An electric time control is a device that applies control to the provision or flow of electrical energy over time.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectrictimecontrol.htm" + }, + "IfcElectricTimeControlType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of electrical time control from which the type required may be set." + }, + "description": "The flow controller type IfcElectricTimeControlType defines commonly shared information for occurrences of electric time controls. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcelectrictimecontroltype.htm" + }, + "IfcElement": { + "attributes": { + "ConnectedFrom": "Reference to the element connection relationship. The relationship then refers to the other element that is connected to this element.", + "ConnectedTo": "Reference to the element connection relationship. The relationship then refers to the other element to which this element is connected to.", + "ContainedInStructure": "Containment relationship to the spatial structure element, to which the element is primarily associated. This containment relationship has to be hierachical, i.e. an element may only be assigned directly to zero or one spatial structure.", + "FillsVoids": "Reference to the _IfcRelFillsElement_ Relationship that puts the element as a filling into the opening created within another element.", + "HasCoverings": "Reference to _IfcCovering_ by virtue of the objectified relationship _IfcRelCoversBldgElement_. It defines the concept of an element having coverings associated.", + "HasOpenings": "Reference to the _IfcRelVoidsElement_ relationship that creates an opening in an element. An element can incorporate zero-to-many openings. For each opening, that voids the element, a new relationship _IfcRelVoidsElement_ is generated.", + "HasProjections": "Projection relationship that adds a feature (using a Boolean union) to the _IfcBuildingElement_.", + "InterferesElements": "Reference to the interference relationship to indicate the element that interferes. The relationship, if provided, indicates that this element has an interference with one or many other elements. > NOTE There is no indication of precedence between _IsInterferedByElements_ and _InterferesElements_.", + "IsConnectionRealization": "Reference to the connection relationship with realizing element. The relationship, if provided, assigns this element as the realizing element to the connection, which provides the physical manifestation of the connection relationship.", + "IsInterferedByElements": "Reference to the interference relationship to indicate the element that is interfered. The relationship, if provided, indicates that this element has an interference with one or many other elements. > NOTE There is no indication of precedence between _IsInterferedByElements_ and _InterferesElements_.", + "ProvidesBoundaries": "Reference to space boundaries by virtue of the objectified relationship _IfcRelSpaceBoundary_. It defines the concept of an element bounding spaces.", + "ReferencedInStructures": "Reference relationship to the spatial structure element, to which the element is additionally associated. This relationship may not be hierarchical, an element may be referenced by zero, one or many spatial structure elements.", + "Tag": "The tag (or label) identifier at the particular instance of a product, e.g. the serial number, or the position number. It is the identifier at the occurrence level." + }, + "description": "An element is a generalization of all components that make up an AEC product.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcelement.htm" + }, + "IfcElementAssembly": { + "attributes": { + "AssemblyPlace": "A designation of where the assembly is intended to take place defined by an Enum.", + "PredefinedType": "Predefined generic types for a element assembly that are specified in an enumeration. There might be property sets defined specifically for each predefined type." + }, + "description": "The IfcElementAssembly represents complex element assemblies aggregated from several elements, such as discrete elements, building elements, or other elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcelementassembly.htm" + }, + "IfcElementAssemblyType": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of the transport element. There may be property set definitions available for each predefined type." + }, + "description": "The IfcElementAssemblyType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcelementassemblytype.htm" + }, + "IfcElementComponent": { + "description": "An element component is a representation for minor items included in, added to or connecting to or between elements, which usually are not of interest from the overall building structure viewpoint. However, these small parts may have vital and load carrying functions within the construction. These items do not provide any actual space boundaries. Typical examples of _IfcElementComponent_s include different kinds of fasteners and various accessories.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcelementcomponent.htm" + }, + "IfcElementComponentType": { + "description": "The element type IfcElementComponentType defines commonly shared information for occurrences of element components. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcelementcomponenttype.htm" + }, + "IfcElementQuantity": { + "attributes": { + "MethodOfMeasurement": "Name of the method of measurement used to calculate the element quantity. The method of measurement attribute has to be made recognizable by further agreements.", + "Quantities": "The individual quantities for the element, can be a set of length, area, volume, weight or count based quantities." + }, + "description": "An IfcElementQuantity defines a set of derived measures of an element's physical property. Elements could be spatial structure elements (like buildings, storeys, or spaces) or building elements (like walls, slabs, finishes). The IfcElementQuantity gets assigned to the element by using the IfcRelDefinesByProperties relationship.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcelementquantity.htm" + }, + "IfcElementType": { + "attributes": { + "ElementType": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED." + }, + "description": "IfcElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcelementtype.htm" + }, + "IfcElementarySurface": { + "attributes": { + "Position": "The position and orientation of the surface. This attribute is used in the definition of the parameterization of the surface." + }, + "description": "An IfcElementarySurface in the common supertype of analytical surfaces.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcelementarysurface.htm" + }, + "IfcEllipse": { + "attributes": { + "SemiAxis1": "The first radius of the ellipse which shall be positive. Placement.Axes[1] gives the direction of the SemiAxis1.", + "SemiAxis2": "The second radius of the ellipse which shall be positive." + }, + "description": "An IfcEllipse is a curve consisting of a set of points whose distances to two fixed points add to the same constant.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcellipse.htm" + }, + "IfcEllipseProfileDef": { + "attributes": { + "SemiAxis1": "The first radius of the ellipse. It is measured along the direction of Position.P[1].", + "SemiAxis2": "The second radius of the ellipse. It is measured along the direction of Position.P[2]." + }, + "description": "IfcEllipseProfileDef defines an ellipse as the profile definition used by the swept surface geometry or the swept area solid. It is given by its semi axis attributes and placed within the 2D position coordinate system, established by the Position attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcellipseprofiledef.htm" + }, + "IfcEnergyConversionDevice": { + "description": "The distribution flow element IfcEnergyConversionDevice defines the occurrence of a device used to perform energy conversion or heat transfer and typically participates in a flow distribution system. Its type is defined by IfcEnergyConversionDeviceType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcenergyconversiondevice.htm" + }, + "IfcEnergyConversionDeviceType": { + "description": "The element type IfcEnergyConversionType defines a list of commonly shared property set definitions of an energy conversion device and an optional set of product representations. It is used to define an energy conversion device specification (the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcenergyconversiondevicetype.htm" + }, + "IfcEngine": { + "attributes": { + "PredefinedType": "" + }, + "description": "An engine is a device that converts fuel into mechanical energy through combustion.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcengine.htm" + }, + "IfcEngineType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The energy conversion device type IfcEngineType defines commonly shared information for occurrences of engines. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcenginetype.htm" + }, + "IfcEvaporativeCooler": { + "attributes": { + "PredefinedType": "" + }, + "description": "An evaporative cooler is a device that cools air by saturating it with water vapor.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcevaporativecooler.htm" + }, + "IfcEvaporativeCoolerType": { + "attributes": { + "PredefinedType": "Defines the type of evaporative cooler." + }, + "description": "The energy conversion device type IfcEvaporativeCoolerType defines commonly shared information for occurrences of evaporative coolers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcevaporativecoolertype.htm" + }, + "IfcEvaporator": { + "attributes": { + "PredefinedType": "" + }, + "description": "An evaporator is a device in which a liquid refrigerent is vaporized and absorbs heat from the surrounding fluid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcevaporator.htm" + }, + "IfcEvaporatorType": { + "attributes": { + "PredefinedType": "Defines the type of evaporator." + }, + "description": "The energy conversion device type IfcEvaporatorType defines commonly shared information for occurrences of evaporators. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcevaporatortype.htm" + }, + "IfcEvent": { + "attributes": { + "EventOccurenceTime": "The date and/or time at which an event occurs.", + "EventTriggerType": "Identifies the predefined types of event trigger from which the type required may be set.", + "PredefinedType": "Identifies the predefined types of an event from which the type required may be set.", + "UserDefinedEventTriggerType": "A user defined event trigger type, the value of which is asserted when the value of an event trigger type is declared as USERDEFINED." + }, + "description": "An IfcEvent is something that happens that triggers an action or response.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcevent.htm" + }, + "IfcEventTime": { + "attributes": { + "ActualDate": "The date on which an event actually occurs. It is a measured value.", + "EarlyDate": "The earliest date on which an event can occur. It is a calculated value.", + "LateDate": "The latest date on which an event can occur. It is a calculated value.", + "ScheduleDate": "The date on which an event is scheduled to occur. The value might be measured or somehow calculated, which is defined by _ScheduleDataOrigin_." + }, + "description": "IfcEventTime captures the time-related information about an event including the different types of event dates (i.e. actual, scheduled, early, and late).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifceventtime.htm" + }, + "IfcEventType": { + "attributes": { + "EventTriggerType": "Identifies the predefined types of event trigger from which the type required may be set.", + "PredefinedType": "Identifies the predefined types of an event from which the type required may be set.", + "UserDefinedEventTriggerType": "A user defined event trigger type, the value of which is asserted when the value of an event trigger type is declared as USERDEFINED." + }, + "description": "An IfcEventType defines a particular type of event that may be specified.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifceventtype.htm" + }, + "IfcExtendedProperties": { + "attributes": { + "Description": "Description for the set of properties.", + "Name": "The name given to the set of properties.", + "Properties": "The set of properties provided for this extended property collection." + }, + "description": "The IfcExtendedProperties is an abstract supertype of all extensible property collections that are applicable to certain characterized entities. Instantiable subtypes of IfcExtendedProperties assign the property collection to a particular characterized entity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcextendedproperties.htm" + }, + "IfcExternalInformation": { + "description": "An IfcExternalInformation is the identification of an information source that is not explicitly represented in the current model or in the project database (as an implementation of the current model). The IfcExternalInformation identifies the external source (classification, document, or library), but not the particular items such as a dictionary entry, a classification notation, or a document reference within the external source", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcexternalinformation.htm" + }, + "IfcExternalReference": { + "attributes": { + "ExternalReferenceForResources": "Reference to all associations between this external reference and objects within the _IfcResourceObjectSelect_ that are tagged by the external reference.", + "Identification": "The _Identification_ provides a unique identifier of the referenced item within the external source (classification, document or library). It may be provided as * a key, e.g. a classification notation, like NF2.3 * a handle * a uuid or guid It may be human readable (such as a key) or not (such as a handle or uuid) depending on the context of its usage (which has to be determined by local agreement).", + "Location": "Location, where the external source (classification, document or library) can be accessed by electronic means. The electronic location is provided as an URI, and would normally be given as an URL location string.", + "Name": "Optional name to further specify the reference. It can provide a human readable identifier (which does not necessarily need to have a counterpart in the internal structure of the document)." + }, + "description": "An IfcExternalReference is the identification of information that is not explicitly represented in the current model or in the project database (as an implementation of the current model). Such information may be contained in classifications, documents or libraries. The IfcExternalReference identifies a particular item, such as a dictionary entry, a classification notation, or a document reference within the external source.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcexternalreference.htm" + }, + "IfcExternalReferenceRelationship": { + "attributes": { + "RelatedResourceObjects": "Objects within the list of _IfcResourceObjectSelect_ that can be tagged by an external reference to a dictionary, library, catalogue, classification or documentation.", + "RelatingReference": "An external reference that can be used to tag an object within the range of _IfcResourceObjectSelect_. > NOTE External references can be a library reference (for example a dictionary or a catalogue reference), a classification reference, or a documentation reference. >" + }, + "description": "IfcExternalReferenceRelationship is a relationship entity that enables objects from the IfcResourceObjectSelect to have the ability to be tagged by external references.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcexternalreferencerelationship.htm" + }, + "IfcExternalSpatialElement": { + "attributes": { + "BoundedBy": "Reference to a set of _IfcRelSpaceBoundary_'s that defines the physical or virtual delimitation of that external spacial element against physical or virtual boundaries.", + "PredefinedType": "Predefined generic types for an external spatial element that are specified in an enumeration. There might be property sets defined specifically for each predefined type." + }, + "description": "The external spatial element defines external regions at the building site. Those regions can be defined:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcexternalspatialelement.htm" + }, + "IfcExternalSpatialStructureElement": { + "description": "The external spatial structure element is an abstract entity provided for different kind of external spaces, regions, and volumes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcexternalspatialstructureelement.htm" + }, + "IfcExternallyDefinedHatchStyle": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcexternallydefinedhatchstyle.htm" + }, + "IfcExternallyDefinedSurfaceStyle": { + "description": "IfcExternallyDefinedSurfaceStyle is a definition of a surface style through referencing an external source, such as a material library for rendering information.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcexternallydefinedsurfacestyle.htm" + }, + "IfcExternallyDefinedTextFont": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcexternallydefinedtextfont.htm" + }, + "IfcExtrudedAreaSolid": { + "attributes": { + "Depth": "The distance the surface is to be swept along the _ExtrudedDirection_.", + "ExtrudedDirection": "The direction in which the surface, provided by _SweptArea_ is to be swept." + }, + "description": "The IfcExtrudedAreaSolid is defined by sweeping a cross section provided by a profile definition. The direction of the extrusion is given by the ExtrudedDirection attribute and the length of the extrusion is given by the Depth attribute. If the planar area has inner boundaries (holes defined), then those holes shall be swept into holes of the solid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcextrudedareasolid.htm" + }, + "IfcExtrudedAreaSolidTapered": { + "attributes": { + "EndSweptArea": "The surface defining the end of the swept area. It is given as a profile definition. The position coordinate system of the _EndSwptArea_ is generated by translating the _SELF\\IfcSweptAreaSolid.Position_ along the _SELF\\IfcExtrudedAreaSolid.ExtrudedDirection_ by the distance of _SELF\\IfcExtrudedAreaSolid.Depth_." + }, + "description": "IfcExtrudedAreaSolidTapered is defined by sweeping a cross section along a linear spine. The cross section may change along the sweep from the shape of the start cross section into the shape of the end cross section. The resulting solid is bounded by three or more faces: A start face, an end face (each defined by start and end planes and sections), and one or more lateral faces. Each lateral face is a ruled surface defined by a pair of corresponding edges of the start and end section.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcextrudedareasolidtapered.htm" + }, + "IfcFace": { + "attributes": { + "Bounds": "Boundaries of the face.", + "HasTextureMaps": "" + }, + "description": "An IfcFace is topological entity used to define surface, bounded by loops, of a shell.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcface.htm" + }, + "IfcFaceBasedSurfaceModel": { + "attributes": { + "Dim": "The space dimensionality of this class, it is always 3. 3", + "FbsmFaces": "The set of connected face sets comprising the face based surface model." + }, + "description": "The IfcFaceBasedSurfaceModel represents the a shape by connected face sets. The connected faces have a dimensionality 2 and are placed in a coordinate space of dimensionality 3.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcfacebasedsurfacemodel.htm" + }, + "IfcFaceBound": { + "attributes": { + "Bound": "The loop which will be used as a face boundary.", + "Orientation": "This indicated whether (TRUE) or not (FALSE) the loop has the same sense when used to bound the face as when first defined. If sense is FALSE the senses of all its component oriented edges are implicitly reversed when used in the face." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcfacebound.htm" + }, + "IfcFaceOuterBound": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcfaceouterbound.htm" + }, + "IfcFaceSurface": { + "attributes": { + "FaceSurface": "The surface which defines the internal shape of the face. This surface may be unbounded. The domain of the face is defined by this surface and the bounding loops in the inherited attribute SELF\\FaceBounds.", + "SameSense": "This flag indicates whether the sense of the surface normal agrees with (TRUE), or opposes (FALSE), the sense of the topological normal to the face." + }, + "description": "The IfcFaceSurface defines the underlying geometry of the associated surface to the face.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcfacesurface.htm" + }, + "IfcFacetedBrep": { + "description": "The IfcFacetedBrep is a manifold solid brep with the restriction that all faces are planar and bounded polygons.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcfacetedbrep.htm" + }, + "IfcFacetedBrepWithVoids": { + "attributes": { + "Voids": "Set of closed shells defining voids within the solid." + }, + "description": "The IfcFacetedBrepWithVoids is a specialization of a faceted B-rep which contains one or more voids in its interior. The voids are represented as closed shells which are defined so that the shell normal point into the void.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcfacetedbrepwithvoids.htm" + }, + "IfcFailureConnectionCondition": { + "attributes": { + "CompressionFailureX": "Compression force in x-direction leading to failure of the connection.", + "CompressionFailureY": "Compression force in y-direction leading to failure of the connection.", + "CompressionFailureZ": "Compression force in z-direction leading to failure of the connection.", + "TensionFailureX": "Tension force in x-direction leading to failure of the connection.", + "TensionFailureY": "Tension force in y-direction leading to failure of the connection.", + "TensionFailureZ": "Tension force in z-direction leading to failure of the connection." + }, + "description": "Defines forces at which a support or connection fails.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcfailureconnectioncondition.htm" + }, + "IfcFan": { + "attributes": { + "PredefinedType": "" + }, + "description": "A fan is a device which imparts mechanical work on a gas. A typical usage of a fan is to induce airflow in a building services air distribution system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcfan.htm" + }, + "IfcFanType": { + "attributes": { + "PredefinedType": "Defines the type of fan typically used in building services." + }, + "description": "The flow moving device type IfcFanType defines commonly shared information for occurrences of fans. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcfantype.htm" + }, + "IfcFastener": { + "attributes": { + "PredefinedType": "Subtype of fastener" + }, + "description": "Representations of fixing parts which are used as fasteners to connect or join elements with other elements. Excluded are mechanical fasteners which are modeled by a separate entity (IfcMechanicalFastener).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcfastener.htm" + }, + "IfcFastenerType": { + "attributes": { + "PredefinedType": "Subtype of fastener" + }, + "description": "The element component type IfcFastenerType defines commonly shared information for occurrences of fasteners. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcfastenertype.htm" + }, + "IfcFeatureElement": { + "description": "A feature element is a generalization of all existence dependent elements which modify the shape and appearance of the associated master element. The IfcFeatureElement offers the ability to handle shape modifiers as semantic objects within the IFC object model.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcfeatureelement.htm" + }, + "IfcFeatureElementAddition": { + "attributes": { + "ProjectsElements": "Reference to the _IfcRelProjectsElement_ relationship that uses this _IfcFeatureElementAddition_ to create a volume addition at an element. The _IfcFeatureElementAddition_ can only be used to create a single addition at a single element using Boolean addition operation." + }, + "description": "A feature element addition is a specialization of the general feature element, that represents an existence dependent element which modifies the shape and appearance of the associated master element. The IfcFeatureElementAddition offers the ability to handle shape modifiers as semantic objects within the IFC object model that add to the shape of the master element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcfeatureelementaddition.htm" + }, + "IfcFeatureElementSubtraction": { + "attributes": { + "VoidsElements": "Reference to the Voids Relationship that uses this Opening Element to create a void within an Element. The Opening Element can only be used to create a single void within a single Element." + }, + "description": "The IfcFeatureElementSubtraction is specialization of the general feature element, that represents an existence dependent elements which modifies the shape and appearance of the associated master element. The IfcFeatureElementSubtraction offers the ability to handle shape modifiers as semantic objects within the IFC object model that subtract from the shape of the master element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcfeatureelementsubtraction.htm" + }, + "IfcFillAreaStyle": { + "attributes": { + "FillStyles": "The set of fill area styles to use in presenting visible curve segments, annotation fill areas or surfaces.", + "ModelorDraughting": "Indication whether the length measures provided for the presentation style are model based, or draughting based." + }, + "description": "An IfcFillAreaStyle provides the style table for presentation information assigned to annotation fill areas or surfaces for hatching and tiling. The IfcFillAreaStyle_defines hatches as model hatches, that is, the distance between hatch lines, or the curve patterns of hatch lines are given in model space dimensions (that have to be scaled using the target plot scale). The _IfcFillAreaStyle allows for the following combinations of defining the style of hatching and tiling:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcfillareastyle.htm" + }, + "IfcFillAreaStyleHatching": { + "attributes": { + "HatchLineAngle": "A plane angle measure determining the direction of the parallel hatching lines.", + "HatchLineAppearance": "The curve style of the hatching lines. Any curve style pattern shall start at the origin of each hatch line.", + "PatternStart": "A distance along the reference hatch line which is the start point for the curve style font pattern of the reference hatch line. If not given, the start point of the curve style font pattern is at the (virtual) hatching coordinate system.", + "PointOfReferenceHatchLine": "A Cartesian point which defines the offset of the reference hatch line from the origin of the (virtual) hatching coordinate system. The origin is used for mapping the fill area style hatching onto an annotation fill area or surface. The reference hatch line would then appear with this offset from the fill style target point. If not given the reference hatch lines goes through the origin of the (virtual) hatching coordinate system.", + "StartOfNextHatchLine": "A repetition factor that determines the distance between adjacent hatch lines. The factor can either be defined by a parallel offset, or by a repeat factor provided by _IfcVector_." + }, + "description": "The IfcFillAreaStyleHatching is used to define simple, vector-based hatching patterns, based on styled straight lines. The curve font, color and thickness is given by the HatchLineAppearance, the angle by the HatchLineAngle and the distance to the next hatch line by StartOfNextHatchLine, being either an offset distance or a vector.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcfillareastylehatching.htm" + }, + "IfcFillAreaStyleTiles": { + "attributes": { + "Tiles": "A set of constituents of the tile being a styled item that is used as the annotation symbol for tiling the filled area.", + "TilingPattern": "A two direction repeat factor defining the shape and relative positioning of the tiles.", + "TilingScale": "The scale factor applied to each tile as it is placed in the annotation fill area." + }, + "description": "The IfcFillAreaStyleTiles defines the filling of an IfcAnnotationFillArea by recurring patterns of styled two dimensional geometry, called a tile. The recurrence pattern is determined by two vectors, that multiply the tile in regular form.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcfillareastyletiles.htm" + }, + "IfcFilter": { + "attributes": { + "PredefinedType": "" + }, + "description": "A filter is an apparatus used to remove particulate or gaseous matter from fluids and gases.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcfilter.htm" + }, + "IfcFilterType": { + "attributes": { + "PredefinedType": "The type of air filter." + }, + "description": "The flow treatment device type IfcFilterType defines commonly shared information for occurrences of filters. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcfiltertype.htm" + }, + "IfcFireSuppressionTerminal": { + "attributes": { + "PredefinedType": "" + }, + "description": "A fire suppression terminal has the purpose of delivering a fluid (gas or liquid) that will suppress a fire.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcfiresuppressionterminal.htm" + }, + "IfcFireSuppressionTerminalType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of fire suppression terminal from which the type required may be set." + }, + "description": "The flow terminal type IfcFireSuppressionTerminalType defines commonly shared information for occurrences of fire suppression terminals. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcfiresuppressionterminaltype.htm" + }, + "IfcFixedReferenceSweptAreaSolid": { + "attributes": { + "Directrix": "The curve used to define the sweeping operation. The solid is generated by sweeping the _SELF\\IfcSweptAreaSolid.SweptArea_ along the _Directrix_.", + "EndParam": "The parameter value on the _Directrix_ at which the sweeping operation ends. < style=\"color:blue\">If no value is provided the end of the sweeping operation is at the end of the _Directrix_.", + "FixedReference": "The direction providing the fixed axis1 (x-axis) direction for orienting the swept area during the sweeping operation along the _Directrix_.", + "StartParam": "The parameter value on the _Directrix_ at which the sweeping operation commences. If no value is provided the start of the sweeping operation is at the start of the Directrix." + }, + "description": "An IfcFixedReferenceSweptAreaSolid is a type of swept area solid which is the result of sweeping an area along a Directrix. The swept area is provided by a subtype of IfcProfileDef. The profile is placed by an implicit cartesian transformation operator at the start point of the sweep, where the profile normal agrees to the tangent of the directrix at this point, and the profile's x-axis agrees to the FixedReference direction. The orientation of the curve during the sweeping operation is controlled by the FixedReference direction.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcfixedreferencesweptareasolid.htm" + }, + "IfcFlowController": { + "description": "The distribution flow element IfcFlowController defines the occurrence of elements of a distribution system that are used to regulate flow through a distribution system. Examples include dampers, valves, switches, and relays. Its type is defined by IfcFlowControllerType or subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowcontroller.htm" + }, + "IfcFlowControllerType": { + "description": "The element type IfcFlowControllerType defines a list of commonly shared property set definitions of a flow controller and an optional set of product representations. It is used to define a flow controller specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowcontrollertype.htm" + }, + "IfcFlowFitting": { + "description": "The distribution flow element IfcFlowFitting defines the occurrence of a junction or transition in a flow distribution system, such as an elbow or tee. Its type is defined by IfcFlowFittingType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowfitting.htm" + }, + "IfcFlowFittingType": { + "description": "The element type IfcFlowFittingType defines a list of commonly shared property set definitions of a flow fitting and an optional set of product representations. It is used to define a flow fitting specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowfittingtype.htm" + }, + "IfcFlowInstrument": { + "attributes": { + "PredefinedType": "" + }, + "description": "A flow instrument reads and displays the value of a particular property of a system at a point, or displays the difference in the value of a property between two points.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcflowinstrument.htm" + }, + "IfcFlowInstrumentType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of flow instrument from which the type required may be set." + }, + "description": "The distribution control element type IfcFlowInstrumentType defines commonly shared information for occurrences of flow instruments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcflowinstrumenttype.htm" + }, + "IfcFlowMeter": { + "attributes": { + "PredefinedType": "" + }, + "description": "A flow meter is a device that is used to measure the flow rate in a system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcflowmeter.htm" + }, + "IfcFlowMeterType": { + "attributes": { + "PredefinedType": "Defines the type of flow meter." + }, + "description": "The flow controller type IfcFlowMeterType defines commonly shared information for occurrences of flow meters. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcflowmetertype.htm" + }, + "IfcFlowMovingDevice": { + "description": "The distribution flow element IfcFlowMovingDevice defines the occurrence of an apparatus used to distribute, circulate or perform conveyance of fluids, including liquids and gases (such as a pump or fan), and typically participates in a flow distribution system. Its type is defined by IfcFlowMovingDeviceType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowmovingdevice.htm" + }, + "IfcFlowMovingDeviceType": { + "description": "The element type IfcFlowMovingDeviceType defines a list of commonly shared property set definitions of a flow moving device and an optional set of product representations. It is used to define a flow moving device specification (i.e. the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowmovingdevicetype.htm" + }, + "IfcFlowSegment": { + "description": "The distribution flow element IfcFlowSegment defines the occurrence of a segment of a flow distribution system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowsegment.htm" + }, + "IfcFlowSegmentType": { + "description": "The element type IfcFlowSegmentType defines a list of commonly shared property set definitions of a flow segment and an optional set of product representations. It is used to define a flow segment specification (the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowsegmenttype.htm" + }, + "IfcFlowStorageDevice": { + "description": "The distribution flow element IfcFlowStorageDevice defines the occurrence of a device that participates in a distribution system and is used for temporary storage (such as a tank). Its type is defined by IfcFlowStorageDeviceType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowstoragedevice.htm" + }, + "IfcFlowStorageDeviceType": { + "description": "The element type IfcFlowStorageDeviceType defines a list of commonly shared property set definitions of a flow storage device and an optional set of product representations. It is used to define a flow storage device specification (the specific product information that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowstoragedevicetype.htm" + }, + "IfcFlowTerminal": { + "description": "The distribution flow element IfcFlowTerminal defines the occurrence of a permanently attached element that acts as a terminus or beginning of a distribution system (such as an air outlet, drain, water closet, or sink). A terminal is typically a point at which a system interfaces with an external environment. Its type is defined by IfcFlowTerminalType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowterminal.htm" + }, + "IfcFlowTerminalType": { + "description": "The element type IfcFlowTerminalType defines a list of commonly shared property set definitions of a flow terminal and an optional set of product representations. It is used to define a flow terminal specification (the specific product information that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowterminaltype.htm" + }, + "IfcFlowTreatmentDevice": { + "description": "The distribution flow element IfcFlowTreatmentDevice defines the occurrence of a device typically used to remove unwanted matter from a fluid, either liquid or gas, and typically participates in a flow distribution system. Its type is defined by IfcFlowTreatmentDeviceType or its subtypes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowtreatmentdevice.htm" + }, + "IfcFlowTreatmentDeviceType": { + "description": "The element type IfcFlowTreatmentDeviceType defines a list of commonly shared property set definitions of a flow treatment device and an optional set of product representations. It is used to define a flow treatment device specification (the specific product information that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcflowtreatmentdevicetype.htm" + }, + "IfcFooting": { + "attributes": { + "PredefinedType": "The generic type of the footing." + }, + "description": "A footing is a part of the foundation of a structure that spreads and transmits the load to the soil. A footing is also characterized as shallow foundation, where the loads are transfered to the ground near the surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcfooting.htm" + }, + "IfcFootingType": { + "attributes": { + "PredefinedType": "Subtype of footing." + }, + "description": "The building element type IfcFootingType defines commonly shared information for occurrences of footings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcfootingtype.htm" + }, + "IfcFurnishingElement": { + "description": "A furnishing element is a generalization of all furniture related objects. Furnishing objects are characterized as being", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcfurnishingelement.htm" + }, + "IfcFurnishingElementType": { + "description": "IfcFurnishingElementType defines a list of commonly shared property set definitions of an element and an optional set of product representations. It is used to define an element specification (the specific product information, that is common to all occurrences of that product type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcfurnishingelementtype.htm" + }, + "IfcFurniture": { + "attributes": { + "PredefinedType": "" + }, + "description": "Furniture defines complete furnishings such as a table, desk, chair, or cabinet, which may or may not be permanently attached to a building structure.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcfurniture.htm" + }, + "IfcFurnitureType": { + "attributes": { + "AssemblyPlace": "A designation of where the assembly is intended to take place. A selection of alternatives s provided in an enumerated list.", + "PredefinedType": "" + }, + "description": "The furnishing element type IfcFurnitureType defines commonly shared information for occurrences of furnitures. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcfurnituretype.htm" + }, + "IfcGeographicElement": { + "attributes": { + "PredefinedType": "Predefined generic types for a geographic element that are specified in an enumeration. There might be property sets defined specifically for each predefined type." + }, + "description": "An IfcGeographicElement is a generalization of all elements within a geographical landscape. It includes occurrences of typical geographical elements, often referred to as features, such as trees or terrain. Common type information behind several occurrences of IfcGeographicElement is provided by the IfcGeographicElementType.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcgeographicelement.htm" + }, + "IfcGeographicElementType": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of the geographic element. There may be property set definitions available for each predefined type." + }, + "description": "An IfcGeographicElementType is used to define an element specification of a geographic element (i.e. the specific product information, that is common to all occurrences of that product type). Geographic element types include for different types of element that may be used to represent information within a geographical landscape external to a building. Within the world of geographic information they are referred to generally as 'features'. IfcGeographicElementType's include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcgeographicelementtype.htm" + }, + "IfcGeometricCurveSet": { + "description": "The IfcGeometricCurveSet is used for the exchange of shape representation consisting of an collection of (2D or 3D) points and curves only.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcgeometriccurveset.htm" + }, + "IfcGeometricRepresentationContext": { + "attributes": { + "CoordinateSpaceDimension": "The integer dimension count of the coordinate space modeled in a geometric representation context.", + "HasCoordinateOperation": "Indicates conversion between coordinate systems. In particular it refers to an _IfcCoordinateOperation_ between a Geographic map coordinate reference system, and the engineering coordinate system of this construction project. If there is more then one _IfcGeometricRepresentationContext_ provided to the _IfcProject_ then all contexts shall have an identical instance of _IfcCoordinateOperation_ as _HasCoordinateOperation_ refering to the same instance of _IfcCoordinateReferenceSystem_.", + "HasSubContexts": "The set of _IfcGeometricRepresentationSubContexts_ that refer to this _IfcGeometricRepresentationContext_.", + "Precision": "Value of the model precision for geometric models. It is a double value (REAL), typically in 1E-5 to 1E-8 range, that indicates the tolerance under which two given points are still assumed to be identical. The value can be used e.g. to sets the maximum distance from an edge curve to the underlying face surface in brep models.", + "TrueNorth": "Direction of the true north, or geographic northing direction, relative to the underlying project coordinate system. It is given by a 2 dimensional direction within the xy-plane of the project coordinate system. If not present, it defaults to 0. 1., meaning that the positive Y axis of the project coordinate system equals the geographic northing direction. > NOTE If a geographic placement is provided using _IfcMapConversion_ then the true north is for information only. In case of inconsistency, the value provided with _IfcMapConversion_ shall take precedence.", + "WorldCoordinateSystem": "Establishment of the engineering coordinate system (often referred to as the world coordinate system in CAD) for all representation contexts used by the project. > NOTE It can be used to provide better numeric stability if the placement of the building(s) is far away from the origin. In most cases however it would be set to origin: (0.,0.,0.) and directions x(1.,0.,0.), y(0.,1.,0.), z(0.,0.,1.). If an geographic placement is provided using _IfcMapConversion_ then the _WorldCoordinateSystem_ atttibute is used to define the offset between the zero point of the local engineering coordinate system and the geographic reference point to which the _IfcMapConversion_ offset relates. In preferred practise both points (also called \"project base point\" and \"survey point\") should be coincidental. However it is possible to offset the geographic reference point from the local zero point." + }, + "description": "The IfcGeometricRepresentationContext defines the context that applies to several shape representations of products within a project. It defines the type of the context in which the shape representation is defined, and the numeric precision applicable to the geometric representation items defined in this context. In addition it can be used to offset the project coordinate system from a global point of origin, using the WorldCoordinateSystem attribute. The main representation context may also provide the true north direction, see Figure 1.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcgeometricrepresentationcontext.htm" + }, + "IfcGeometricRepresentationItem": { + "description": "An IfcGeometricRepresentationItem is the common supertype of all geometric items used within a representation. It is positioned within a geometric coordinate system, directly or indirectly through intervening items.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcgeometricrepresentationitem.htm" + }, + "IfcGeometricRepresentationSubContext": { + "attributes": { + "CoordinateSpaceDimension": "ParentContext.CoordinateSpaceDimension", + "ParentContext": "Parent context from which the sub context derives its world coordinate system, precision, space coordinate dimension and true north.", + "Precision": "NVL(ParentContext.Precision,1.E-5)", + "TargetScale": "The target plot scale of the representation to which this representation context applies. > NOTE Scale indicates the target plot scale for the representation sub context, all annotation styles are given in plot dimensions according to this target plot scale. > If multiple instances of _IfcGeometricRepresentationSubContext_ are given having the same _TargetView_ value, the target plot scale applies up to the next smaller scale, or up to unlimited small scale. > NOTE Scale 1:100 (given as 0.01 within _TargetScale_) is bigger then 1:200 (given as 0.005 within _TargetScale_).", + "TargetView": "Target view of the representation to which this representation context applies.", + "TrueNorth": "NVL(ParentContext.TrueNorth, IfcConvertDirectionInto2D(SELF\\IfcGeometricRepresentationContext.WorldCoordinateSystem.P[2]))", + "UserDefinedTargetView": "User defined target view, this attribute value shall be given, if the TargetView attribute is set to USERDEFINED.", + "WorldCoordinateSystem": "ParentContext.WorldCoordinateSystem" + }, + "description": "IfcGeometricRepresentationSubContext defines the context that applies to several shape representations of a product being a sub context, sharing the WorldCoordinateSystem, CoordinateSpaceDimension, Precision and TrueNorth attributes with the parent IfcGeometricRepresentationContext.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcgeometricrepresentationsubcontext.htm" + }, + "IfcGeometricSet": { + "attributes": { + "Dim": "The space dimensionality of this class, it is identical to the first element in the set. A where rule ensures that all elements have the same dimensionality. Elements[1].Dim", + "Elements": "The geometric elements which make up the geometric set, these may be points, curves or surfaces; but are required to be of the same coordinate space dimensionality." + }, + "description": "The IfcGeometricSet is used for the exchange of shape representation consisting of (2D or 3D) points, curves, and surfaces, which do not have a topological structure (such as connected face sets or shells), are not tessellated and are not solid models (such as swept solids, CSG or Brep).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcgeometricset.htm" + }, + "IfcGrid": { + "attributes": { + "ContainedInStructure": "Relationship to a spatial structure element, to which the grid is primarily associated.", + "PredefinedType": "Predefined types to define the particular type of the grid.", + "UAxes": "List of grid axes defining the first row of grid lines.", + "VAxes": "List of grid axes defining the second row of grid lines.", + "WAxes": "List of grid axes defining the third row of grid lines. It may be given in the case of a triangular grid." + }, + "description": "IfcGrid ia a planar design grid defined in 3D space used as an aid in locating structural and design elements. The position of the grid (ObjectPlacement) is defined by a 3D coordinate system (and thereby the design grid can be used in plan, section or in any position relative to the world coordinate system). The position can be relative to the object placement of other products or grids. The XY plane of the 3D coordinate system is used to place the grid axes, which are 2D curves (for example, line, circle, arc, polyline).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcgrid.htm" + }, + "IfcGridAxis": { + "attributes": { + "AxisCurve": "Underlying curve which provides the geometry for this grid axis.", + "AxisTag": "The tag or name for this grid axis.", + "HasIntersections": "The reference to a set of IFC2x3 CHANGE New inverse attribute.", + "PartOfU": "If provided, the _IfcGridAxis_ is part of the _UAxes_ of _IfcGrid_.", + "PartOfV": "If provided, the _IfcGridAxis_ is part of the _VAxes_ of _IfcGrid_.", + "PartOfW": "If provided, the _IfcGridAxis_ is part of the _WAxes_ of _IfcGrid_.", + "SameSense": "Defines whether the original sense of curve is used or whether it is reversed in the context of the grid axis." + }, + "description": "An individual axis, IfcGridAxis, is defined in the context of a design grid. The axis definition is based on a curve of dimensionality 2. The grid axis is positioned within the XY plane of the position coordinate system defined by the IfcGrid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcgridaxis.htm" + }, + "IfcGridPlacement": { + "attributes": { + "PlacementLocation": "Placement of the object coordinate system defined by the intersection of two grid axes.", + "PlacementRefDirection": "Reference to either an explicit direction, or a second grid axis intersection, which defines the orientation of the grid placement." + }, + "description": "IfcGridPlacement provides a specialization of IfcObjectPlacement in which the placement and axis direction of the object coordinate system is defined by a reference to the design grid as defined in IfcGrid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcgridplacement.htm" + }, + "IfcGroup": { + "attributes": { + "IsGroupedBy": "Reference to the relationship _IfcRelAssignsToGroup_ that assigns the one to many group members to the _IfcGroup_ object." + }, + "description": "IfcGroup is an generalization of any arbitrary group. A group is a logical collection of objects. It does not have its own position, nor can it hold its own shape representation. Therefore a group is an aggregation under some non-geometrical / topological grouping aspects.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcgroup.htm" + }, + "IfcHalfSpaceSolid": { + "attributes": { + "AgreementFlag": "The agreement flag is TRUE if the normal to the BaseSurface points away from the material of the IfcHalfSpaceSolid. Otherwise it is FALSE.", + "BaseSurface": "Surface defining side of half space.", + "Dim": "The space dimensionality of this class, it is always 3 3" + }, + "description": "A half space solid divides the domain into two by a base surface. Normally, the base surface is a plane and devides the infinitive space into two and indicates the side of the half-space by agreeing or disagreeing to the normal of the plane.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifchalfspacesolid.htm" + }, + "IfcHeatExchanger": { + "attributes": { + "PredefinedType": "" + }, + "description": "A heat exchanger is a device used to provide heat transfer between non-mixing media such as plate and shell and tube heat exchangers.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcheatexchanger.htm" + }, + "IfcHeatExchangerType": { + "attributes": { + "PredefinedType": "Defines the basic types of heat exchanger (e.g., plate, shell and tube, etc.)." + }, + "description": "The energy conversion device type IfcHeatExchangerType defines commonly shared information for occurrences of heat exchangers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcheatexchangertype.htm" + }, + "IfcHumidifier": { + "attributes": { + "PredefinedType": "" + }, + "description": "A humidifier is a device that adds moisture into the air.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifchumidifier.htm" + }, + "IfcHumidifierType": { + "attributes": { + "PredefinedType": "Defines the type of humidifier." + }, + "description": "The energy conversion device type IfcHumidifierType defines commonly shared information for occurrences of humidifiers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifchumidifiertype.htm" + }, + "IfcIShapeProfileDef": { + "attributes": { + "FilletRadius": "The fillet between the web and the flange. 0 if sharp-edged, omitted if unknown.", + "FlangeEdgeRadius": "Radius of the lower edges of the top flange and the upper edges of the bottom flange. 0 if sharp-edged, omitted if unknown.", + "FlangeSlope": "Slope of the lower faces of the top flange and of the upper faces of the bottom flange. Non-zero in case of tapered flanges, 0 in case of parallel flanges, omitted if unknown.", + "FlangeThickness": "Flange thickness of the I-shape. Both, the upper and the lower flanges have the same thickness and they are centred on the y-axis of the position coordinate system.", + "OverallDepth": "Total extent of the depth, defined parallel to the y axis of the position coordinate system.", + "OverallWidth": "Total extent of the width, defined parallel to the x axis of the position coordinate system.", + "WebThickness": "Thickness of the web of the I-shape. The web is centred on the x-axis and the y-axis of the position coordinate system." + }, + "description": "IfcIShapeProfileDef defines a section profile that provides the defining parameters of an 'I' or 'H' section. The I-shape profile has values for its overall depth, width and its web and flange thicknesses. Additionally a fillet radius, flange edge radius, and flange slope may be given. This profile definition represents an I-section which is symmetrical about its major and minor axes; top and bottom flanges are equal and centred on the web.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcishapeprofiledef.htm" + }, + "IfcImageTexture": { + "attributes": { + "URLReference": "Location, provided as an URI, at which the image texture is electronically published." + }, + "description": "An IfcImageTexture provides a 2-dimensional texture that can be applied to a surface of an geometric item and that provides lighting parameters of a surface onto which it is mapped. The texture is provided as an image file at an external location for which an URL is provided.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcimagetexture.htm" + }, + "IfcIndexedColourMap": { + "attributes": { + "ColourIndex": "Index into the _IfcColourRgbList_ for each face of the _IfcTriangulatedFaceSet_. The colour is applied uniformly to the indexed face.", + "Colours": "Indexable list of lists of quadruples, representing RGB colours.", + "MappedTo": "Reference to the _IfcTessellatedFaceSet_ to which it applies the colours and alpha channel.", + "Opacity": "The the opacity value, that applies equaly to all faces of the tessellated face set. 1.0 means opaque, and 0.0 completely transparent. If not provided, 1.0 is assumed (all colours are opque). > NOTE The definition of the alpha channel component for opacity follows the new definitions in image processing, where 0.0 means full transparency and 1.0 (or 2^bit depths^ -1) means fully opaque. This is contrary to the definition of transparency in _IfcSurfaceStyleShading_." + }, + "description": "The IfcIndexedColourMap provides the assignment of colour information to individual faces. It is used for colouring faces of tessellated face sets. The IfcIndexedColourMap defines an index into an indexed list of colour information. The Colours are a two-dimensional list of colours provided by three RGB values. The ColourIndex attribute corresponds to the CoordIndex of the IfcTessellatedFaceSet defining the corresponding index list of faces. The Opacity attribute provides the alpha channel for all faces of the tessellated face set.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcindexedcolourmap.htm" + }, + "IfcIndexedPolyCurve": { + "attributes": { + "Points": "A list of points, provided by a point list of either two, or three dimensions, that is used to define the poly curve. If the attribute _Segments_ is not provided, the poly curve is generated as a poly line by connecting the points in the order of their appearance in the point list. If the attribute _Segments_ is provided, the segments determine, how the points are to be used to create straigth and circular arc segments.", + "Segments": "List of straight line and circular arc segments, each providing a list of indices into the Cartesian point list. Indices should preserve consecutive connectivity between the segments, the start index of the next segment shall be identical with the end index of the previous segment.", + "SelfIntersect": "Indication of whether the curve intersects itself or not; this is for information only." + }, + "description": "The IfcIndexedPolyCurve is a bounded curve with only linear and circular arc segments defined by a Cartesian point list and an optional list of segments, providing indices into the Cartesian point list. In the case that the list of Segments is not provided, all points in the IfcCartesianPointList are connected by straight line segments in the order they appear in the IfcCartesianPointList.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcindexedpolycurve.htm" + }, + "IfcIndexedPolygonalFace": { + "attributes": { + "CoordIndex": "One-dimensional list with the indices for the three or more points, that define the vertices of the outer loop. If the tessellated face set is closed, indicated by _SELF\\IfcTessellatedFaceSet.Closed_, then the points, defining the outer loop, shall connect counter clockwise, as seen from the outside of the body, so that the resulting normal will point outwards. > NOTE The coordinates of the vertices are provided by the indexed list of _SELF\\IfcTessellatedFaceSet.Coordinates.CoordList_. If the _SELF\\IfcTessellatedFaceSet.PnIndex_ is provided, the indices point into it, otherwise directly into the _IfcCartesianPointList3D_.", + "ToFaceSet": "Reference to the _IfcPolygonalFaceSet_ for which this face is associated." + }, + "description": "The IfcIndexedPolygonalFace is a compact representation of a planar face being part of a face set. The vertices of the polygonal planar face are provided by 3 or more Cartesian points, defined by indices that point into an IfcCartesianPointList3D, either direcly, or via the PnIndex, if provided at IfcPolygonalFaceSet.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcindexedpolygonalface.htm" + }, + "IfcIndexedPolygonalFaceWithVoids": { + "attributes": { + "InnerCoordIndices": "Two-dimensional list, where the first dimension represents each inner loop (from 1 to N) and the second dimension the indices to three or more points that define the vertices of each inner loop. If the tessellated face set is closed, indicated by _SELF\\IfcTessellatedFaceSet.Closed_, then the points, defining the inner loops, shall connect clockwise, as seen from the outside of the body. > NOTE The coordinates of the vertices are provided by the indexed list of _SELF\\IfcTessellatedFaceSet.Coordinates.CoordList_. If the _SELF\\IfcTessellatedFaceSet.PnIndex_ is provided, the indices point into it, otherwise directly into the _IfcCartesianPointList3D_." + }, + "description": "The IfcIndexedPolygonalFaceWithVoids is a compact representation of a planar face with inner loops, being part of a face set.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcindexedpolygonalfacewithvoids.htm" + }, + "IfcIndexedTextureMap": { + "attributes": { + "MappedTo": "Reference to the _IfcTessellatedFaceSet_ to which it applies the texture map.", + "TexCoords": "Indexable list of texture vertices." + }, + "description": "The IfcIndexedTextureMap provides the mapping of the 2-dimensional texture coordinates to the surface onto which it is mapped. It is used for mapping the texture to faces of tessellated face sets.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcindexedtexturemap.htm" + }, + "IfcIndexedTriangleTextureMap": { + "attributes": { + "TexCoordIndex": "Index into the _IfcTextureVertexList_ for each vertex of the triangles representing the _IfcTriangulatedFaceSet_." + }, + "description": "The IfcIndexedTriangleTextureMap provides the mapping of the 2-dimensional texture coordinates to the surface onto which it is mapped. It is used for mapping the texture to triangles of the IfcTriangulatedFaceSet.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcindexedtriangletexturemap.htm" + }, + "IfcInterceptor": { + "attributes": { + "PredefinedType": "" + }, + "description": "An interceptor is a device designed and installed in order to separate and retain deleterious, hazardous or undesirable matter while permitting normal sewage or liquids to discharge into a collection system by gravity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcinterceptor.htm" + }, + "IfcInterceptorType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The flow treatment device type IfcInterceptorType defines commonly shared information for occurrences of interceptors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcinterceptortype.htm" + }, + "IfcIntersectionCurve": { + "description": "An IfcIntersectionCurve is a 3-dimensional curve that has two additional representations provided by two pcurves defined within two distinct and intersecting surfaces.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcintersectioncurve.htm" + }, + "IfcInventory": { + "attributes": { + "CurrentValue": "An estimate of the current cost value of the inventory.", + "Jurisdiction": "The organizational unit to which the inventory is applicable.", + "LastUpdateDate": "The date on which the last update of the inventory was carried out.", + "OriginalValue": "An estimate of the original cost value of the inventory.", + "PredefinedType": "A list of the types of inventories from which that required may be selected.", + "ResponsiblePersons": "Persons who are responsible for the inventory." + }, + "description": "An inventory is a list of items within an enterprise.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcinventory.htm" + }, + "IfcIrregularTimeSeries": { + "attributes": { + "Values": "The collection of time series values." + }, + "description": "In an irregular time series, unpredictable bursts of data arrive at unspecified points in time, or most time stamps cannot be characterized by a repeating pattern.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcirregulartimeseries.htm" + }, + "IfcIrregularTimeSeriesValue": { + "attributes": { + "ListValues": "A list of time-series values. At least one value is required.", + "TimeStamp": "The specification of the time point." + }, + "description": "The IfcIrregularTimeSeriesValue describes a value (or set of values) at a particular time point.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcirregulartimeseriesvalue.htm" + }, + "IfcJunctionBox": { + "attributes": { + "PredefinedType": "" + }, + "description": "A junction box is an enclosure within which cables are connected.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcjunctionbox.htm" + }, + "IfcJunctionBoxType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of junction boxes from which the type required may be set." + }, + "description": "The flow fitting type IfcJunctionBoxType defines commonly shared information for occurrences of junction boxs. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcjunctionboxtype.htm" + }, + "IfcLShapeProfileDef": { + "attributes": { + "Depth": "Leg length, see illustration above (= h). Same as the overall depth.", + "EdgeRadius": "Edge radius according the above illustration (= r2).", + "FilletRadius": "Fillet radius according the above illustration (= r1).", + "LegSlope": "Slope of the inner face of each leg of the profile.", + "Thickness": "Constant wall thickness of profile, see illustration above (= ts).", + "Width": "Leg length, see illustration above (= b). Same as the overall width. This attribute is formally optional for historic reasons only. Whenever the width is known, it shall be provided by value." + }, + "description": "IfcLShapeProfileDef defines a section profile that provides the defining parameters of an L-shaped section (equilateral L profiles are also covered by this entity) to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The shorter leg has the same direction as the positive Position.P[1]-axis, the longer or equal leg the same as the positive Position.P[2]-axis. The centre of the position coordinate system is in the profiles centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifclshapeprofiledef.htm" + }, + "IfcLaborResource": { + "attributes": { + "PredefinedType": "Defines types of labour resources." + }, + "description": "An IfcLaborResource is used in construction with particular skills or crafts required to perform certain types of construction or management related work.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifclaborresource.htm" + }, + "IfcLaborResourceType": { + "attributes": { + "PredefinedType": "Defines types of labour resources." + }, + "description": "The resource type IfcLaborResourceType defines commonly shared information for occurrences of labour resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifclaborresourcetype.htm" + }, + "IfcLagTime": { + "attributes": { + "DurationType": "The allowed types of task duration that specify the lag time measurement (work time or elapsed time).", + "LagValue": "Value of the time lag selected as being either a ratio or a time measure." + }, + "description": "IfcLagTime describes the time parameters that may exist within a sequence relationship between two processes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifclagtime.htm" + }, + "IfcLamp": { + "attributes": { + "PredefinedType": "" + }, + "description": "A lamp is an artificial light source such as a light bulb or tube.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifclamp.htm" + }, + "IfcLampType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of lamp from which the type required may be set." + }, + "description": "The flow terminal type IfcLampType defines commonly shared information for occurrences of lamps. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifclamptype.htm" + }, + "IfcLibraryInformation": { + "attributes": { + "Description": "Additional description provided for the library revision information.", + "HasLibraryReferences": "The library references to which the library information applies.", + "LibraryInfoForObjects": "The library information with which objects are associated.", + "Location": "Resource identifier or locator, provided as URI, URN or URL, of the library information for online references.", + "Name": "The name which is used to identify the library.", + "Publisher": "Information of the organization that acts as the library publisher.", + "Version": "Identifier for the library version used for reference.", + "VersionDate": "Date of the referenced version of the library." + }, + "description": "An IfcLibraryInformation describes a library where a library is a structured store of information, normally organized in a manner which allows information lookup through an index or reference value. IfcLibraryInformation provides the library Name and optional Description, Version, VersionDate and Publisher attributes. A Location may be added for electronic access to the library.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifclibraryinformation.htm" + }, + "IfcLibraryReference": { + "attributes": { + "Description": "Additional description provided for the library reference.", + "Language": "The language in which a library reference is expressed.", + "LibraryRefForObjects": "The library reference with which objects are associated.", + "ReferencedLibrary": "The library information that is being referenced." + }, + "description": "An IfcLibraryReference is a reference into a library of information by Location (provided as a URI). It also provides an optional inherited Identification key to allow more specific references to library sections or tables. The inherited Name attribute allows for a human interpretable identification of the library item. Also, general information on the library from which the reference is taken, is given by the ReferencedLibrary relation which identifies the relevant occurrence of IfcLibraryInformation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifclibraryreference.htm" + }, + "IfcLightDistributionData": { + "attributes": { + "LuminousIntensity": "The luminous intensity distribution measure for this pair of main and secondary plane angles according to the light distribution curve chosen.", + "MainPlaneAngle": "The main plane angle (A, B or C angles, according to the light distribution curve chosen).", + "SecondaryPlaneAngle": "The list of secondary plane angles (the \u03b1, \u03b2 or \u03b3 angles) according to the light distribution curve chosen. > NOTE The _SecondaryPlaneAngle_ and _LuminousIntensity_ lists are corresponding lists." + }, + "description": "IfcLightDistributionData defines the luminous intensity of a light source given at a particular main plane angle. It is based on some standardized light distribution curves; the MainPlaneAngle is either the", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightdistributiondata.htm" + }, + "IfcLightFixture": { + "attributes": { + "PredefinedType": "" + }, + "description": "A light fixture is a container that is designed for the purpose of housing one or more lamps and optionally devices that control, restrict or vary their emission.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifclightfixture.htm" + }, + "IfcLightFixtureType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of light fixture from which the type required may be set." + }, + "description": "The flow terminal type IfcLightFixtureType defines commonly shared information for occurrences of light fixtures. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifclightfixturetype.htm" + }, + "IfcLightIntensityDistribution": { + "attributes": { + "DistributionData": "Light distribution data applied to the light source. It is defined by a list of main plane angles (B or C according to the light distribution curve chosen) that includes (for each B or C angle) a second list of secondary plane angles (the \u03b2 or \u03b3 angles) and the according luminous intensity distribution measures.", + "LightDistributionCurve": "Standardized light distribution curve used to define the luminous intensity of the light in all directions." + }, + "description": "IfcLightIntensityDistribution defines the the luminous intensity of a light source that changes according to the direction of the ray. It is based on some standardized light distribution curves, which are defined by the LightDistributionCurve attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightintensitydistribution.htm" + }, + "IfcLightSource": { + "attributes": { + "AmbientIntensity": "Definition from VRML97 - ISO/IEC 14772-1:1997: The ambientIntensity specifies the intensity of the ambient emission from the light. Light intensity may range from 0.0 (no light emission) to 1.0 (full intensity).", + "Intensity": "Definition from VRML97 - ISO/IEC 14772-1:1997: The intensity field specifies the brightness of the direct emission from the ligth. Light intensity may range from 0.0 (no light emission) to 1.0 (full intensity).", + "LightColour": "Definition from ISO/CD 10303-46:1992: Based on the current lighting model, the colour of the light to be used for shading. Definition from VRML97 - ISO/IEC 14772-1:1997: The color field specifies the spectral color properties of both the direct and ambient light emission as an RGB value.", + "Name": "The name given to the light source in presentation." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsource.htm" + }, + "IfcLightSourceAmbient": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsourceambient.htm" + }, + "IfcLightSourceDirectional": { + "attributes": { + "Orientation": "Definition from ISO/CD 10303-46:1992: This direction is the direction of the light source. Definition from VRML97 - ISO/IEC 14772-1:1997: The direction field specifies the direction vector of the illumination emanating from the light source in the local coordinate system. Light is emitted along parallel rays from an infinite distance away." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsourcedirectional.htm" + }, + "IfcLightSourceGoniometric": { + "attributes": { + "ColourAppearance": "Artificial light sources are classified in terms of their color appearance. To the human eye they all appear to be white; the difference can only be detected by direct comparison. Visual performance is not directly affected by differences in color appearance.", + "ColourTemperature": "The color temperature of any source of radiation is defined as the temperature (in Kelvin) of a black-body or Planckian radiator whose radiation has the same chromaticity as the source of radiation. Often the values are only approximate color temperatures as the black-body radiator cannot emit radiation of every chromaticity value. The color temperatures of the commonest artificial light sources range from less than 3000K (warm white) to 4000K (intermediate) and over 5000K (daylight).", + "LightDistributionDataSource": "The data source from which light distribution data is obtained.", + "LightEmissionSource": "Identifies the types of light emitter from which the type required may be set.", + "LuminousFlux": "Luminous flux is a photometric measure of radiant flux, i.e. the volume of light emitted from a light source. Luminous flux is measured either for the interior as a whole or for a part of the interior (partial luminous flux for a solid angle). All other photometric parameters are derivatives of luminous flux. Luminous flux is measured in lumens (lm). The luminous flux is given as a nominal value for each lamp.", + "Position": "The position of the light source. It is used to orientate the light distribution curves." + }, + "description": "IfcLightSourceGoniometric defines a light source for which exact lighting data is available. It specifies the type of a light emitter, defines the position and orientation of a light distribution curve and the data concerning lamp and photometric information.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsourcegoniometric.htm" + }, + "IfcLightSourcePositional": { + "attributes": { + "ConstantAttenuation": "Definition from ISO/CD 10303-46:1992: This real indicates the value of the attenuation in the lighting equation that is constant.", + "DistanceAttenuation": "Definition from ISO/CD 10303-46:1992: This real indicates the value of the attenuation in the lighting equation that proportional to the distance from the light source.", + "Position": "Definition from ISO/CD 10303-46:1992: The Cartesian point indicates the position of the light source. Definition from VRML97 - ISO/IEC 14772-1:1997: A Point light node illuminates geometry within radius of its location.", + "QuadricAttenuation": "This real indicates the value of the attenuation in the lighting equation that proportional to the square value of the distance from the light source.", + "Radius": "The maximum distance from the light source for a surface still to be illuminated. Definition from VRML97 - ISO/IEC 14772-1:1997: A Point light node illuminates geometry within radius of its location." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsourcepositional.htm" + }, + "IfcLightSourceSpot": { + "attributes": { + "BeamWidthAngle": "Definition from VRML97 - ISO/IEC 14772-1:1997: The beamWidth field specifies an inner solid angle in which the light source emits light at uniform full intensity. The light source's emission intensity drops off from the inner solid angle (beamWidthAngle) to the outer solid angle (spreadAngle).", + "ConcentrationExponent": "Definition from ISO/CD 10303-46:1992: This real is the exponent on the cosine of the angle between the line that starts at the position of the spot light source and is in the direction of the orientation of the spot light source and a line that starts at the position of the spot light source and goes through a point on the surface being shaded. NOTE This attribute does not exists in ISO/IEC 14772-1:1997.", + "Orientation": "Definition from ISO/CD 10303-46:1992: This is the direction of the axis of the cone of the light source specified in the coordinate space of the representation being projected.. Definition from VRML97 - ISO/IEC 14772-1:1997: The direction field specifies the direction vector of the light's central axis defined in the local coordinate system.", + "SpreadAngle": "Definition from ISO/CD 10303-46:1992: This planar angle measure is the angle between the line that starts at the position of the spot light source and is in the direction of the spot light source and any line on the boundary of the cone of influence. Definition from VRML97 - ISO/IEC 14772-1:1997: The cutOffAngle (name of spread angle in VRML) field specifies the outer bound of the solid angle. The light source does not emit light outside of this solid angle." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifclightsourcespot.htm" + }, + "IfcLine": { + "attributes": { + "Dir": "The direction of the _IfcLine_, the magnitude and units of _Dir_ affect the parameterization of the line.", + "Pnt": "The location of the _IfcLine_." + }, + "description": "The IfcLine is an unbounded line parameterized by an IfcCartesianPoint and an IfcVector. The magnitude of the IfcVector affects the parameterization of the line, but it does not bound the line.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcline.htm" + }, + "IfcLocalPlacement": { + "attributes": { + "PlacementRelTo": "Reference to Object that provides the relative placement by its local coordinate system. If it is omitted, then the local placement is given to the WCS, established by the geometric representation context.", + "RelativePlacement": "Geometric placement that defines the transformation from the related coordinate system into the relating. The placement can be either 2D or 3D, depending on the dimension count of the coordinate system." + }, + "description": "An IfcLocalPlacement defines the relative placement of a product in relation to the placement of another product or the absolute placement of a product within the geometric representation context of the project.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifclocalplacement.htm" + }, + "IfcLoop": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcloop.htm" + }, + "IfcManifoldSolidBrep": { + "attributes": { + "Outer": "A closed shell defining the exterior boundary of the solid. The shell normal shall point away from the interior of the solid." + }, + "description": "The IfcManifoldSolidBrep is a solid represented as a collection of connected surfaces that delimit the solid from the surrounding non-solid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcmanifoldsolidbrep.htm" + }, + "IfcMapConversion": { + "attributes": { + "Eastings": "Specifies the location along the easting of the coordinate system of the target map coordinate reference system. > NOTE for right-handed Cartesian coordinate systems this would establish the location along the x axis.", + "Northings": "Specifies the location along the northing of the coordinate system of the target map coordinate reference system. > NOTE for right-handed Cartesian coordinate systems this would establish the location along the y axis", + "OrthogonalHeight": "Orthogonal height relativ to the vertical datum specified. > NOTE for right-handed Cartesian coordinate systems this would establish the location along the z axis", + "Scale": "Scale to be used, when the units of the CRS are not identical to the units of the engineering coordinate system. If omited, the value of 1.0 is assumed.", + "XAxisAbscissa": "Specifies the value along the easing axis of the end point of a vector indicating the position of the local x axis of the engineering coordinate reference system. > NOTE 1 for right-handed Cartesian coordinate systems this would establish the location along the x axis > NOTE 2 together with the _XAxisOrdinate_ it provides the direction of the local x axis within the horizontal plane of the map coordinate system", + "XAxisOrdinate": "Specifies the value along the northing axis of the end point of a vector indicating the position of the local x axis of the engineering coordinate reference system. > NOTE 1 for right-handed Cartesian coordinate systems this would establish the location along the y axis" + }, + "description": "The map conversion deals with transforming the local engineering coordinate system, often called world coordinate system, into the coordinate reference system of the underlying map.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcmapconversion.htm" + }, + "IfcMappedItem": { + "attributes": { + "MappingSource": "A representation map that is the source of the mapped item. It can be seen as a block (or cell or marco) definition.", + "MappingTarget": "A representation item that is the target onto which the mapping source is mapped. It is constraint to be a Cartesian transformation operator." + }, + "description": "The IfcMappedItem is the inserted instance of a source definition (to be compared with a block / shared cell / macro definition). The instance is inserted by applying a Cartesian transformation operator as the MappingTarget.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcmappeditem.htm" + }, + "IfcMaterial": { + "attributes": { + "Category": "Definition of the category (group or type) of material, in more general terms than given by attribute _Name_. > EXAMPLE A view definition may require each _Material.Name_ to be unique, e.g. for each concrete or steel grade used in a project, in which case _Material.Category_ could take the values 'Concrete' or 'Steel'.", + "Description": "Definition of the material in more descriptive terms than given by attributes _Name_ or _Category_.", + "HasRepresentation": "Reference to the _IfcMaterialDefinitionRepresentation_ that provides presentation information to a representation common to this material in style definitions.", + "IsRelatedWith": "Reference to a material relationship indicating that this material is a part (or constituent) in a material composite.", + "Name": "Name of the material. > EXAMPLE A view definition may require _Material.Name_ to uniquely specify e.g. concrete or steel grade, in which case the attribute Material.Category could take the value 'Concrete' or 'Steel'. > NOTE Material grade may have different meaning in different view definitions, e.g. strength grade for structural design and analysis, or visible appearance grade in architectural application. Also, more elaborate material grade definition may be associated as classification via inverse attribute _HasExternalReferences_.", + "RelatesTo": "Reference to a material relationship indicating that this material composite has parts (or constituents)." + }, + "description": "IfcMaterial is a homogeneous or inhomogeneous substance that can be used to form elements (physical products or their components).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterial.htm" + }, + "IfcMaterialClassificationRelationship": { + "attributes": { + "ClassifiedMaterial": "Material being classified.", + "MaterialClassifications": "The material classifications identifying the type of material." + }, + "description": "IfcMaterialClassificationRelationship is a relationship assigning classifications to materials.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialclassificationrelationship.htm" + }, + "IfcMaterialConstituent": { + "attributes": { + "Category": "Category of the material constituent, e.g. the role it has in the constituent set it belongs to.", + "Description": "Definition of the material constituent in descriptive terms.", + "Fraction": "Optional provision of a fraction of the total amount (volume or weight) that applies to the _IfcMaterialConstituentSet_ that is contributed by this _IfcMaterialConstituent_.", + "Material": "Reference to the material from which the constituent is constructed.", + "Name": "The name by which the material constituent is known.", + "ToMaterialConstituentSet": "Material constituent set in which this material constituent is included." + }, + "description": "IfcMaterialConstituent is a single and identifiable part of an element which is constructed of a number of part (one or more) each having an individual material. The association of the material constituent to the part is provided by a keyword as value of the Name attribute. In order to identify and distinguish the part of the shape representation to which the material constituent applies the IfcProductDefinitionShape of the element has to include instances of IfcShapeAspect, using the same keyword for their Name attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialconstituent.htm" + }, + "IfcMaterialConstituentSet": { + "attributes": { + "Description": "Definition of the material constituent set in descriptive terms.", + "MaterialConstituents": "Identification of the constituents from which the material constituent set is composed.", + "Name": "The name by which the constituent set is known." + }, + "description": "IfcMaterialConstituentSet is a collection of individual material constituents, each assigning a material to a part of an element. The parts are only identified by a keyword (as opposed to an IfcMaterialLayerSet or IfcMaterialProfileSet where each part has an individual shape parameter (layer thickness or layer profile).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialconstituentset.htm" + }, + "IfcMaterialDefinition": { + "attributes": { + "AssociatedTo": "Use of the _IfcMaterialDefinition_ subtypes within the material association of an element occurrence or element type. The association is established by the _IfcRelAssociatesMaterial_ relationship.", + "HasExternalReferences": "Reference to external references, e.g. library, classification, or document information, that are associated to the material.", + "HasProperties": "Material properties assigned to instances of subtypes of _IfcMaterialDefinition_." + }, + "description": "IfcMaterialDefinition is a general supertype for all material related information items in IFC that have common material related properties that may include association of material with some shape parameters or assignments to identified parts of a component.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialdefinition.htm" + }, + "IfcMaterialDefinitionRepresentation": { + "attributes": { + "RepresentedMaterial": "Reference to the material to which the representation applies." + }, + "description": "IfcMaterialDefinitionRepresentation defines presentation information relating to IfcMaterial. It allows for multiple presentations of the same material for different geometric representation contexts.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcmaterialdefinitionrepresentation.htm" + }, + "IfcMaterialLayer": { + "attributes": { + "Category": "Category of the material layer, e.g. the role it has in the layer set it belongs to (such as 'load bearing', 'thermal insulation' etc.). The list of keywords might be extended by model view definitions, however the following keywords shall apply in general: * 'LoadBearing' \u2014 for all material layers having a load bearing function. * 'Insulation' \u2014 for all material layers having an insolating function. * 'Finish' \u2014 for the material layer being the inner or outer finish.", + "Description": "Definition of the material layer in more descriptive terms than given by attributes Name or Category.", + "IsVentilated": "Indication of whether the material layer represents an air layer (or cavity). * set to TRUE if the material layer is an air gap and provides air exchange from the layer to the outside air. * set to UNKNOWN if the material layer is an air gap and does not provide air exchange (or when this information about air exchange of the air gap is not available). * set to FALSE if the material layer is a solid material layer (the default).", + "LayerThickness": "The thickness of the material layer. The meaning of \"thickness\" depends on its usage. In case of building elements elements utilizing _IfcMaterialLayerSetUsage_, the dimension is measured along the positive _LayerSetDirection_ as specified in _IfcMaterialLayerSetUsage_. > NOTE The attribute value can be 0. for material thicknesses very close to zero, such as for a membrane. Material layers with thickess 0. may not be rendered in the geometric representation.", + "Material": "Optional reference to the material from which the layer is constructed. Note that if this value is not given, it does not denote a layer with no material (an air gap), it only means that the material is not specified at that point.", + "Name": "The name by which the material layer is known.", + "Priority": "The relative priority of the layer, expressed as normalised integer range [0..100]. Controls how layers intersect in connections and corners of building elements: a layer from one element protrudes into (i.e. displaces) a layer from another element in a joint of these elements if the former element's layer has higher priority than the latter. The priority value for a material layer in an element has to be set and maintained by software applications in relation to the material layers in connected elements. > NOTE The layer priority at a connection may be overridden by the priority attributes of _IfcRelConnectsPathElements_ if that relationship is used to establish a logical connection between two building elements having a layer structure.", + "ToMaterialLayerSet": "Reference to the _IfcMaterialLayerSet_ in which the material layer is included." + }, + "description": "IfcMaterialLayer is a single and identifiable part of an element which is constructed of a number of layers (one or more). Each IfcMaterialLayer has a constant thickness and is located relative to the referencing IfcMaterialLayerSet along the material layer set base (MlsBase).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmateriallayer.htm" + }, + "IfcMaterialLayerSet": { + "attributes": { + "Description": "Definition of the _IfcMaterialLayerSet_ in descriptive terms.", + "LayerSetName": "The name by which the _IfcMaterialLayerSet_ is known.", + "MaterialLayers": "Identification of the _IfcMaterialLayer_\u2019s from which the _IfcMaterialLayerSet_ is composed.", + "TotalThickness": "Total thickness of the material layer set is derived from the function _IfcMlsTotalThickness._ IfcMlsTotalThickness(SELF)" + }, + "description": "The IfcMaterialLayerSet is a designation by which materials of an element constructed of a number of material layers is known and through which the relative positioning of individual layers can be expressed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmateriallayerset.htm" + }, + "IfcMaterialLayerSetUsage": { + "attributes": { + "DirectionSense": "Denotes whether the material layer set is oriented in positive or negative sense along the specified axis (defined by LayerSetDirection). \"Positive\" means that the consecutive layers (the _IfcMaterialLayer_ instances in the list of _IfcMaterialLayerSet.MaterialLayers_) are placed face-by-face in the direction of the positive axis as established by LayerSetDirection: for AXIS2 it would be in +y, for AXIS3 it would be +z. \"Negative\" means that the layers are placed face-by-face in the direction of the negative LayerSetDirection. In both cases, starting at the material layer set base line. > NOTE the material layer set base line (MlsBase) is located by OffsetFromReferenceLine, and may be on the positive or negative side of the element reference line (or plane); positive or negative for MlsBase placement does not depend on the DirectionSense attribute, but on the relevant element axis.", + "ForLayerSet": "The _IfcMaterialLayerSet_ set to which the usage is applied.", + "LayerSetDirection": "Orientation of the material layer set relative to element reference geometry. The meaning of the value of this attribute shall be specified in the geometry use section for each element. For extruded shape representation, direction can be given along the extrusion path (e.g. for slabs) or perpendicular to it (e.g. for walls). > NOTE The _LayerSetDirection_ for _IfcWallStandardCase_ shall be AXIS2 (i.e. the y-axis) and for _IfcSlabStandardCase_ and _IfcPlateStandardCase_ it shall be AXIS3 (i.e. the z-axis). > NOTE Whether the material layers of the set being used shall 'grow' into the positive or negative direction of the given axis, shall be defined by _DirectionSense_ attribute.", + "OffsetFromReferenceLine": "Offset of the material layer set base line (MlsBase) from reference geometry (line or plane) of element. The offset can be positive or negative, unless restricted for a particular building element type in its use definition or by implementer agreement. A positive value means, that the MlsBase is placed on the positive side of the reference line or plane, on the axis established by LayerSetDirection (in case of AXIS2 into the direction of +y, or in case of AXIS2 into the direction of +z). A negative value means that the MlsBase is placed on the negative side, as established by LayerSetDirection (in case of AXIS2 into the direction of -y). > NOTE the positive or negative sign in the offset only affects the MlsBase placement, it does not have any effect on the application of DirectionSense for orientation of the material layers; also DirectionSense does not change the MlsBase placement.", + "ReferenceExtent": "Extent of the extrusion of the elements body shape representation to which the _IfcMaterialLayerSetUsage_ applies. It is used as the reference value for the upper _OffsetValues[2]_ provided by the _IfcMaterialLayerSetWithOffsets_ subtype for included material layers." + }, + "description": "The IfcMaterialLayerSetUsage determines the usage of IfcMaterialLayerSet in terms of its location and orientation relative to the associated element geometry. The location of material layer set shall be compatible with the building element geometry (that is, material layers shall fit inside the element geometry). The rules to ensure the compatibility depend on the type of the building element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmateriallayersetusage.htm" + }, + "IfcMaterialLayerWithOffsets": { + "attributes": { + "OffsetDirection": "Orientation of the offset; shall be perpendicular to the parent layer set direction.", + "OffsetValues": "The numerical value of layer offset, in the direction of the axis assigned by the attribute _OffsetDirection_. The _OffsetValues[1]_ identifies the offset from the lower position along the axis direction (normally the start of the standard extrusion), the _OffsetValues[2]_ identifies the offset from the upper position along the axis direction (normally the end of the standard extrusion)." + }, + "description": "IfcMaterialLayerWithOffsets is a specialization of IfcMaterialLayer enabling definition of offset values along edges (within the material layer set usage in parent layer set).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmateriallayerwithoffsets.htm" + }, + "IfcMaterialList": { + "attributes": { + "Materials": "Materials used in a composition of substances." + }, + "description": "IfcMaterialList is a list of the different materials that are used in an element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmateriallist.htm" + }, + "IfcMaterialProfile": { + "attributes": { + "Category": "Category of the material profile, e.g. the role it has in the profile set it belongs to. The list of keywords might be extended by model view definitions, however the following keywords shall apply in general: * 'LoadBearing' \u2014 the material profile having a load bearing function. * 'Insulation' \u2014 the material profile having an insolating function. * 'Finish' \u2014 the material profile being the finish.", + "Description": "Definition of the material profile in descriptive terms.", + "Material": "Optional reference to the material from which the profile is constructed.", + "Name": "The name by which the material profile is known.", + "Priority": "The relative priority of the profile, expressed as normalised integer range [0..100]. Controls how profiles intersect in connections and corners of building elements: A profile from one element protrudes into (i.e. displaces) a profile from another element in a joint of these elements if the former element's profile has higher priority than the latter. The priority value for a material profile in an element has to be set and maintained by software applications in relation to the material profiles in connected elements.", + "Profile": "Identification of the profile for which this material profile is associating material.", + "ToMaterialProfileSet": "Material profile set in which this material profile is included." + }, + "description": "IfcMaterialProfile is a single and identifiable cross section of an element which is constructed of a number of profiles (one or more).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialprofile.htm" + }, + "IfcMaterialProfileSet": { + "attributes": { + "CompositeProfile": "Reference to the composite profile definition for which this material profile set associates material to each of its individual profiles. If only a single material profile is used (the most typical case) then no _CompositeProfile_ is asserted. > NOTE The referenced _IfcCompositeProfileDef_ instance shall be composed of all of the _IfcProfileDef_ instances which are used via the MaterialProfiles list in the current _IfcMaterialProfileSet_.", + "Description": "Definition of the material profile set in descriptive terms.", + "MaterialProfiles": "Identification of the profiles from which the material profile set is composed.", + "Name": "The name by which the material profile set is known." + }, + "description": "The IfcMaterialProfileSet is a designation by which individual material(s) of a prismatic element (for example, beam or column) constructed of a single or multiple material profiles is known.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialprofileset.htm" + }, + "IfcMaterialProfileSetUsage": { + "attributes": { + "CardinalPoint": "Index reference to a significant point in the section profile. Describes how the section is aligned relative to the (longitudinal) axis of the member it is associated with. This parametric specification of profile alignment can be provided redundantly to the explicit alignment defined by ForProfileSet.MaterialProfiles[\\*].Profile.", + "ForProfileSet": "The _IfcMaterialProfileSet_ set to which the usage is applied.", + "ReferenceExtent": "Extent of the extrusion of the elements body shape representation to which the _IfcMaterialProfileSetUsage_ applies. It is used as the reference value for the upper _OffsetValues[2]_ provided by the _IfcMaterialProfileSetWithOffsets_ subtype for included material profiles. > NOTE The attribute _ReferenceExtent_ shall be asserted if an _IfcMaterialProfileSetWithOffsets_ is included in the _ForProfileSet.MaterialProfiles_ list of material layers. > NOTE The _ReferenceExtent_ for _IfcBeamStandardCase_, _IfcColumnStandardCase_, and _IfcMemberStandardCase_ is the reference length starting at z=0 being the XY plane of the object coordinate system." + }, + "description": "IfcMaterialProfileSetUsage determines the usage of IfcMaterialProfileSet in terms of its location relative to the associated element geometry. The location of a material profile set shall be compatible with the building element geometry (that is, material profiles shall fit inside the element geometry). The rules to ensure the compatibility depend on the type of the building element. For building elements with shape representations which are based on extruded solids, this is accomplished by referring to the identical profile definition in the shape model as in the material profile set.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialprofilesetusage.htm" + }, + "IfcMaterialProfileSetUsageTapering": { + "attributes": { + "CardinalEndPoint": "Index reference to a significant point in the second section profile. Describes how this section is aligned relative to the axis of the member it is associated with. This parametric specification of profile alignment can be provided redundantly to the explicit alignment defined by ForProfileSet.MaterialProfiles[\\*].Profile.", + "ForProfileEndSet": "The second _IfcMaterialProfileSet_ set to which the usage is applied." + }, + "description": "IfcMaterialProfileSetUsageTapering specifies dual material profile sets in association with tapered prismatic (beam- or column-like) elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialprofilesetusagetapering.htm" + }, + "IfcMaterialProfileWithOffsets": { + "attributes": { + "OffsetValues": "The numerical value of profile offset, in the direction of the axis direction - always AXIS1 that is, the axis along the extrusion path. The _OffsetValues[1]_ identifies the offset from the lower position along the axis direction (normally the start of the standard extrusion), the _OffsetValues[2]_ identifies the offset from the upper position along the axis direction (normally the end of the standard extrusion)." + }, + "description": "IfcMaterialProfileWithOffsets is a specialization of IfcMaterialProfile with additional longitudinal offsets .", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialprofilewithoffsets.htm" + }, + "IfcMaterialProperties": { + "attributes": { + "Material": "Reference to the material definition to which the set of properties is assigned." + }, + "description": "The IfcMaterialProperties assigns a set of material properties to associated material definitions. The set may be identified by a Name and a Description. The IfcProperty (instantiable subtypes) is used to express the individual material properties by name, description, value and unit.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialproperties.htm" + }, + "IfcMaterialRelationship": { + "attributes": { + "Expression": "Information about the material relationship refering for example to the amount of related materials in the composite material. > NOTE Any formal meaning of the _Expression_ string value has to be established in model view definitions or implementer agreements. No such formal language is provided as part of this specification.", + "RelatedMaterials": "Reference to related materials (as constituents of composite material).", + "RelatingMaterial": "Reference to the relating material (the composite)." + }, + "description": "IfcMaterialRelationship defines a relationship between part and whole in material definitions (as in composite materials). The parts, expressed by the set of RelatedMaterials, are material constituents of which a single material aggregate is composed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialrelationship.htm" + }, + "IfcMaterialUsageDefinition": { + "attributes": { + "AssociatedTo": "Use of the _IfcMaterialUsageDefinition_ subtypes within the material association of an element occurrence. The association is established by the _IfcRelAssociatesMaterial_ relationship." + }, + "description": "IfcMaterialUsageDefinition is a general supertype for all material related information items in IFC that have occurrence specific assignment parameters to assign a set of materials with shape parameters to a reference geometry item of that component.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/lexical/ifcmaterialusagedefinition.htm" + }, + "IfcMeasureWithUnit": { + "attributes": { + "UnitComponent": "The unit in which the physical quantity is expressed.", + "ValueComponent": "The value of the physical quantity when expressed in the specified units." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcmeasurewithunit.htm" + }, + "IfcMechanicalFastener": { + "attributes": { + "NominalDiameter": "The nominal diameter describing the cross-section size of the fastener type. > Deprecated in IFC4", + "NominalLength": "The nominal length describing the longitudinal dimensions of the fastener type. > Deprecated in IFC4", + "PredefinedType": "Subtype of mechanical fastener" + }, + "description": "A mechanical fasteners connecting building elements mechanically. A single instance of this class may represent one or many of actual mechanical fasteners, for example an array of bolts or a row of nails.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcmechanicalfastener.htm" + }, + "IfcMechanicalFastenerType": { + "attributes": { + "NominalDiameter": "The nominal diameter describing the cross-section size of the fastener type.", + "NominalLength": "The nominal length describing the longitudinal dimensions of the fastener type.", + "PredefinedType": "Subtype of mechanical fastener" + }, + "description": "The element component type IfcMechanicalFastenerType defines commonly shared information for occurrences of mechanical fasteners. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/lexical/ifcmechanicalfastenertype.htm" + }, + "IfcMedicalDevice": { + "attributes": { + "PredefinedType": "" + }, + "description": "A medical device is attached to a medical piping system and operates upon medical gases to perform a specific function. Medical gases include medical air, medical vacuum, oxygen, carbon dioxide, nitrogen, and nitrous oxide.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcmedicaldevice.htm" + }, + "IfcMedicalDeviceType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The flow terminal type IfcMedicalDeviceType defines commonly shared information for occurrences of medical devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcmedicaldevicetype.htm" + }, + "IfcMember": { + "attributes": { + "PredefinedType": "Predefined generic type for a member that is specified in an enumeration. There may be a property set given for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcMemberType_ is assigned, providing its own _IfcMemberType.PredefinedType_." + }, + "description": "An IfcMember is a structural member designed to carry loads between or beyond points of support. It is not required to be load bearing. The orientation of the member (being horizontal, vertical or sloped) is not relevant to its definition (in contrary to IfcBeam and IfcColumn). An IfcMember represents a linear structural element from an architectural or structural modeling point of view and shall be used if it cannot be expressed more specifically as either an IfcBeam or an IfcColumn.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcmember.htm" + }, + "IfcMemberStandardCase": { + "description": "The standard member, IfcMemberStandardCase, defines a member with certain constraints for the provision of material usage, parameters and with certain constraints for the geometric representation. The IfcMemberStandardCase handles all cases of members, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcmemberstandardcase.htm" + }, + "IfcMemberType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a linear structural member element from which the type required may be set." + }, + "description": "The element type IfcMemberType defines commonly shared information for occurrences of members. Members are predominately linear building elements, often forming part of a structural system. The orientation of the member (being horizontal, vertical or sloped) is not relevant to its definition (in contrary to beam and column). The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcmembertype.htm" + }, + "IfcMetric": { + "attributes": { + "Benchmark": "Enumeration that identifies the type of benchmark data.", + "DataValue": "The value to be compared on associated objects. A null value indicates comparison to null.", + "ReferencePath": "Optional path to an attribute to be constrained on associated objects. If provided, the metric may be validated by resolving the path to the current value on associated object(s), and comparing such value with _DataValue_ according to the _Benchmark_.", + "ValueSource": "Reference source for data values. If _DataValue_ refers to an _IfcTable_, this attribute identifies the relevent column identified by _IfcTableColumn_._Identifier_." + }, + "description": "An IfcMetric is used to capture quantitative resultant metrics that can be applied to objectives.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstraintresource/lexical/ifcmetric.htm" + }, + "IfcMirroredProfileDef": { + "attributes": { + "Operator": "IfcRepresentationItem() || IfcGeometricRepresentationItem() || IfcCartesianTransformationOperator( -- Axis1 IfcRepresentationItem() || IfcGeometricRepresentationItem() || IfcDirection([-1., 0.]), -- Axis2 IfcRepresentationItem() || IfcGeometricRepresentationItem() || IfcDirection([ 0., 1.]), -- LocalOrigin IfcRepresentationItem() || IfcGeometricRepresentationItem() || IfcPoint() || IfcCartesianPoint([0., 0.]), -- Scale 1.) || IfcCartesianTransformationOperator2D()" + }, + "description": "The IfcMirroredProfileDef defines the profile by mirroring the parent profile about the y axis of the parent profile coordinate system. That is, left and right of the parent profile are swapped.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcmirroredprofiledef.htm" + }, + "IfcMonetaryUnit": { + "attributes": { + "Currency": "Code or name of the currency. Permissible values are the three-letter alphabetic currency codes as per [ISO 4217](http://www.iso.org/iso/support/faqs/faqs_widely_used_standards/widely_used_standards_other/currency_codes/currency_codes_list-1.htm){ target=\"_top\"}, for example CNY, EUR, GBP, JPY, USD." + }, + "description": "IfcMonetaryUnit is a unit to define currency for money.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcmonetaryunit.htm" + }, + "IfcMotorConnection": { + "attributes": { + "PredefinedType": "" + }, + "description": "A motor connection provides the means for connecting a motor as the driving device to the driven device.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcmotorconnection.htm" + }, + "IfcMotorConnectionType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of motor connection from which the type required may be set." + }, + "description": "The energy conversion device type IfcMotorConnectionType defines commonly shared information for occurrences of motor connections. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcmotorconnectiontype.htm" + }, + "IfcNamedUnit": { + "attributes": { + "Dimensions": "The dimensional exponents of the SI base units by which the named unit is defined.", + "UnitType": "The type of the unit." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcnamedunit.htm" + }, + "IfcObject": { + "attributes": { + "Declares": "Link to the relationship object pointing to the reflected object(s) that receives the object definitions. The reflected object has to be part of an object occurrence decomposition. The associated _IfcObject_, or its subtypes, provides the specific information (as part of a type, or style, definition), that is common to all reflected instances of the declaring _IfcObject_, or its subtypes.", + "IsDeclaredBy": "Link to the relationship object pointing to the declaring object that provides the object definitions for this object occurrence. The declaring object has to be part of an object type decomposition. The associated _IfcObject_, or its subtypes, contains the specific information (as part of a type, or style, definition), that is common to all reflected instances of the declaring _IfcObject_, or its subtypes.", + "IsDefinedBy": "Set of relationships to property set definitions attached to this object. Those statically or dynamically defined properties contain alphanumeric information content that further defines the object.", + "IsTypedBy": "Set of relationships to the object type that provides the type definitions for this object occurrence. The then associated _IfcTypeObject_, or its subtypes, contains the specific information (or type, or style), that is common to all instances of _IfcObject_, or its subtypes, referring to the same type.", + "ObjectType": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute _PredefinedType_ is set to USERDEFINED." + }, + "description": "An IfcObject is the generalization of any semantically treated thing or process. Objects are things as they appear - i.e. occurrences.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcobject.htm" + }, + "IfcObjectDefinition": { + "attributes": { + "Decomposes": "References to the decomposition relationship being an aggregation. It determines that this object definition is a part within an unordered whole/part decomposition relationship. An object definitions can only be part of a single decomposition (to allow hierarchical strutures only).", + "HasAssignments": "Reference to the relationship objects, that assign (by an association relationship) other subtypes of IfcObject to this object instance. Examples are the association to products, processes, controls, resources or groups.", + "HasAssociations": "Reference to the relationship objects, that associates external references or other resource definitions to the object.. Examples are the association to library, documentation or classification.", + "HasContext": "References to the context providing context information such as project unit or representation context. It should only be asserted for the uppermost non-spatial object.", + "IsDecomposedBy": "References to the decomposition relationship being an aggregation. It determines that this object definition is whole within an unordered whole/part decomposition relationship. An object definitions can be aggregated by several other objects (occurrences or parts).", + "IsNestedBy": "References to the decomposition relationship being a nesting. It determines that this object definition is the whole within an ordered whole/part decomposition relationship. An object or object type can be nested by several other objects (occurrences or types).", + "Nests": "References to the decomposition relationship being a nesting. It determines that this object definition is a part within an ordered whole/part decomposition relationship. An object occurrence or type can only be part of a single decomposition (to allow hierarchical strutures only)." + }, + "description": "An IfcObjectDefinition is the generalization of any semantically treated thing or process, either being a type or an occurrences. Object defintions can be named, using the inherited Name attribute, which should be a user recognizable label for the object occurrance. Further explanations to the object can be given using the inherited Description attribute. A context is a specific kind of object definition as it provides the project or library context in which object types and object occurrences are defined.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcobjectdefinition.htm" + }, + "IfcObjectPlacement": { + "attributes": { + "PlacesObject": "The _IfcObjectPlacement_ shall be used to provide a placement and an object coordinate system for instances of _IfcProduct_.", + "ReferencedByPlacements": "Placements that are given relative to this placement of an object." + }, + "description": "IfcObjectPlacement is an abstract supertype for the special types defining the object coordinate system. The IfcObjectPlacement has to be provided for each product that has a shape representation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcobjectplacement.htm" + }, + "IfcObjective": { + "attributes": { + "BenchmarkValues": "A list of nested constraints.", + "LogicalAggregator": "Enumeration that identifies the logical type of aggregation for the benchmark metrics.", + "ObjectiveQualifier": "Enumeration that qualifies the type of objective constraint.", + "UserDefinedQualifier": "A user defined value that qualifies the type of objective constraint when ObjectiveQualifier attribute of type _IfcObjectiveEnum_ has value USERDEFINED." + }, + "description": "An IfcObjective captures qualitative information for an objective-based constraint.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstraintresource/lexical/ifcobjective.htm" + }, + "IfcOccupant": { + "attributes": { + "PredefinedType": "Predefined occupant types from which that required may be set." + }, + "description": "An occupant is a type of actor that defines the form of occupancy of a property.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcoccupant.htm" + }, + "IfcOffsetCurve2D": { + "attributes": { + "BasisCurve": "The curve that is being offset.", + "Distance": "The distance of the offset curve from the basis curve. distance may be positive, negative or zero. A positive value of distance defines an offset in the direction which is normal to the curve in the sense of an anti-clockwise rotation through 90 degrees from the tangent vector T at the given point. (This is in the direction of orthogonal complement(T).)", + "SelfIntersect": "An indication of whether the offset curve self-intersects; this is for information only." + }, + "description": "An IfcOffsetCurve2D is a curve defined by an offset in 2D space from its BasisCurve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcoffsetcurve2d.htm" + }, + "IfcOffsetCurve3D": { + "attributes": { + "BasisCurve": "The curve that is being offset.", + "Distance": "The distance of the offset curve from the basis curve. The distance may be positive, negative or zero.", + "RefDirection": "The direction used to define the direction of the offset curve 3d from the basis curve.", + "SelfIntersect": "An indication of whether the offset curve self-intersects, this is for information only." + }, + "description": "An IfcOffsetCurve3D is a curve defined by an offset in 3D space from its BasisCurve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcoffsetcurve3d.htm" + }, + "IfcOpenShell": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcopenshell.htm" + }, + "IfcOpeningElement": { + "attributes": { + "HasFillings": "Reference to the Filling Relationship that is used to assign Elements as Fillings for this Opening Element. The Opening Element can be filled with zero-to-many Elements.", + "PredefinedType": "Predefined generic type for an opening that is specified in an enumeration. There may be a property set given specificly for the predefined types." + }, + "description": "The opening element stands for opening, recess or chase, all reflecting voids. It represents a void within any element that has physical manifestation. Openings can be inserted into walls, slabs, beams, columns, or other elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcopeningelement.htm" + }, + "IfcOpeningStandardCase": { + "description": "The standard opening, IfcOpeningStandardCase, defines an opening with certain constraints for the dimension parameters, position within the voided element, and with certain constraints for the geometric representation. The IfcOpeningStandardCase handles all cases of openings, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcopeningstandardcase.htm" + }, + "IfcOrganization": { + "attributes": { + "Addresses": "Postal and telecom addresses of an organization. > NOTE There may be several addresses related to an organization.", + "Description": "Text that relates the nature of the organization.", + "Engages": "Inverse relationship to IfcPersonAndOrganization relationships in which IfcOrganization is engaged.", + "Identification": "Identification of the organization.", + "IsRelatedBy": "The inverse relationship for relationship RelatedOrganizations of IfcOrganizationRelationship.", + "Name": "The word, or group of words, by which the organization is referred to.", + "Relates": "The inverse relationship for relationship RelatingOrganization of IfcOrganizationRelationship.", + "Roles": "Roles played by the organization." + }, + "description": "A named and structured grouping with a corporate identity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcorganization.htm" + }, + "IfcOrganizationRelationship": { + "attributes": { + "RelatedOrganizations": "The other, possibly dependent, organizations which are the related parts of the relationship between organizations.", + "RelatingOrganization": "Organization which is the relating part of the relationship between organizations." + }, + "description": "The IfcOrganizationRelationship establishes an association between one relating organization and one or more related organizations.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcorganizationrelationship.htm" + }, + "IfcOrientedEdge": { + "attributes": { + "EdgeElement": "Edge entity used to construct this oriented edge.", + "EdgeEnd": "The end vertex of the oriented edge. It derives from the vertices of the edge element after taking account of the orientation. IfcBooleanChoose (Orientation, EdgeElement.EdgeEnd, EdgeElement.EdgeStart)", + "EdgeStart": "The start vertex of the oriented edge. It derives from the vertices of the edge element after taking account of the orientation. IfcBooleanChoose (Orientation, EdgeElement.EdgeStart, EdgeElement.EdgeEnd)", + "Orientation": "BOOLEAN, If TRUE the topological orientation as used coincides with the orientation from start vertex to end vertex of the edge element. If FALSE otherwise." + }, + "description": "The IfcOrientedEdge represents an IfcEdge with an Orientation flag applied. It allows to reuse the same IfcEdge when traversed exactly twice, once forwards and once backwards.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcorientededge.htm" + }, + "IfcOuterBoundaryCurve": { + "description": "The IfcOuterBoundaryCurve defines the outer boundary of a bounded surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcouterboundarycurve.htm" + }, + "IfcOutlet": { + "attributes": { + "PredefinedType": "" + }, + "description": "An outlet is a device installed at a point to receive one or more inserted plugs for electrical power or communications.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcoutlet.htm" + }, + "IfcOutletType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of outlet from which the type required may be set." + }, + "description": "The flow terminal type IfcOutletType defines commonly shared information for occurrences of outlets. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcoutlettype.htm" + }, + "IfcOwnerHistory": { + "attributes": { + "ChangeAction": "Enumeration that defines the actions associated with changes made to the object.", + "CreationDate": "The date and time expressed in UTC (Universal Time Coordinated, formerly Greenwich Mean Time or GMT) when first created by the original OwningApplication. Once defined this value remains unchanged through the lifetime of the entity.", + "LastModifiedDate": "Date and Time expressed in UTC (Universal Time Coordinated, formerly Greenwich Mean Time or GMT) at which the last modification was made by LastModifyingUser and LastModifyingApplication.", + "LastModifyingApplication": "Application used to make the last modification.", + "LastModifyingUser": "User who carried out the last modification using LastModifyingApplication.", + "OwningApplication": "Direct reference to the application which currently \"owns\" this object on behalf of the owning user of the application. Note that IFC includes the concept of ownership transfer from one application to another and therefore distinguishes between the Owning Application and Creating Application.", + "OwningUser": "Direct reference to the end user who currently \"owns\" this object. Note that IFC includes the concept of ownership transfer from one user to another and therefore distinguishes between the Owning User and Creating User.", + "State": "Enumeration that defines the current access state of the object." + }, + "description": "IfcOwnerHistory defines all history and identification related information. In order to provide fast access it is directly attached to all independent objects, relationships and properties.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcutilityresource/lexical/ifcownerhistory.htm" + }, + "IfcParameterizedProfileDef": { + "attributes": { + "Position": "Position coordinate system of the parameterized profile definition. If unspecified, no translation and no rotation is applied." + }, + "description": "The parameterized profile definition defines a 2D position coordinate system to which the parameters of the different profiles relate to. All profiles are defined centric to the origin of the position coordinate system, or more specific, the origin [0.,0.] shall be in the center of the bounding box of the profile.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcparameterizedprofiledef.htm" + }, + "IfcPath": { + "attributes": { + "EdgeList": "The list of oriented edges which are concatenated together to form this path." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcpath.htm" + }, + "IfcPcurve": { + "attributes": { + "BasisSurface": "", + "ReferenceCurve": "" + }, + "description": "The IfcPcurve is a curve defined within the parameter space of its reference surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcpcurve.htm" + }, + "IfcPerformanceHistory": { + "attributes": { + "LifeCyclePhase": "Describes the applicable building life-cycle phase. Typical values should be DESIGNDEVELOPMENT, SCHEMATICDEVELOPMENT, CONSTRUCTIONDOCUMENT, CONSTRUCTION, ASBUILT, COMMISSIONING, OPERATION, etc.", + "PredefinedType": "Predefined generic type for a performace history that is specified in an enumeration." + }, + "description": "IfcPerformanceHistory is used to document the actual performance of an occurrence instance over time. It includes machine-measured data from building automation systems and human-specified data such as task and resource usage. The data may represent actual conditions, predictions, or simulations.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccontrolextension/lexical/ifcperformancehistory.htm" + }, + "IfcPermeableCoveringProperties": { + "attributes": { + "FrameDepth": "Depth of panel frame (used to include the permeable covering), measured from front face to back face horizontally (i.e. perpendicular to the window or door (elevation) plane.", + "FrameThickness": "Width of panel frame (used to include the permeable covering), measured from inside of panel (at permeable covering) to outside of panel (at lining), i.e. parallel to the window or door (elevation) plane.", + "OperationType": "Types of permeable covering operations. Also used to assign standard symbolic presentations according to national building standards.", + "PanelPosition": "Position of this permeable covering panel within the overall window or door type.", + "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the permeable covering." + }, + "description": "This entity is a description of a panel within a door or window (as fillers for opening) which allows for air flow. It is given by its properties (IfcPermeableCoveringProperties). A permeable covering is a casement, such as a component, fixed or opening, consisting essentially of a frame and the infilling. The infilling is normally a grill, a louver or a screen. The way of operation is defined in the operation type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcpermeablecoveringproperties.htm" + }, + "IfcPermit": { + "attributes": { + "LongDescription": "Detailed description of the request.", + "PredefinedType": "Identifies the predefined types of permit that can be granted.", + "Status": "The status currently assigned to the permit." + }, + "description": "A permit is a permission to perform work in places and on artifacts where regulatory, security or other access restrictions apply.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/lexical/ifcpermit.htm" + }, + "IfcPerson": { + "attributes": { + "Addresses": "Postal and telecommunication addresses of a person. > NOTE A person may have several addresses.", + "EngagedIn": "The inverse relationship to IfcPersonAndOrganization relationships in which IfcPerson is engaged.", + "FamilyName": "The name by which the family identity of the person may be recognized. > NOTE Depending on geographical location and culture, family name may appear either as the first or last component of a name.", + "GivenName": "The name by which a person is known within a family and by which he or she may be familiarly recognized. > NOTE Depending on geographical location and culture, given name may appear either as the first or last component of a name.", + "Identification": "Identification of the person.", + "MiddleNames": "Additional names given to a person that enable their identification apart from others who may have the same or similar family and given names. > NOTE Middle names are not normally used in familiar communication but may be asserted to provide additional identification of a particular person if necessary. They may be particularly useful in situations where the person concerned has a family name that occurs commonly in the geographical region.", + "PrefixTitles": "The word, or group of words, which specify the person's social and/or professional standing and appear before his/her names.", + "Roles": "Roles played by the person.", + "SuffixTitles": "The word, or group of words, which specify the person's social and/or professional standing and appear after his/her names." + }, + "description": "This entity represents an individual human being.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcperson.htm" + }, + "IfcPersonAndOrganization": { + "attributes": { + "Roles": "Roles played by the person within the context of an organization. These may differ from the roles in _ThePerson.Roles_ which may be asserted without organizational context.", + "TheOrganization": "The organization to which the person is related.", + "ThePerson": "The person who is related to the organization." + }, + "description": "This entity represents a person acting on behalf of an organization.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcpersonandorganization.htm" + }, + "IfcPhysicalComplexQuantity": { + "attributes": { + "Discrimination": "Identification of the discrimination by which this physical complex property is distinguished. Examples of discriminations are 'layer', 'steel bar diameter', etc.", + "HasQuantities": "Set of physical quantities that are grouped by this complex physical quantity according to a given discrimination.", + "Quality": "Additional indication of a quality of the quantities that are grouped under this physical complex quantity.", + "Usage": "Additional indication of a usage type of the quantities that are grouped under this physical complex quantity." + }, + "description": "The complex physical quantity, IfcPhysicalComplexQuantity, is an entity that holds a set of single quantity measure value (as defined at the subtypes of IfcPhysicalSimpleQuantity), that all apply to a given component or aspect of the element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcphysicalcomplexquantity.htm" + }, + "IfcPhysicalQuantity": { + "attributes": { + "Description": "Further explanation that might be given to the quantity.", + "HasExternalReferences": "Reference to an external reference, e.g. library, classification, or document information, that is associated to the quantity.", + "Name": "Name of the element quantity or measure. The name attribute has to be made recognizable by further agreements.", + "PartOfComplex": "Reference to a physical complex quantity in which the physical quantity may be contained." + }, + "description": "The physical quantity, IfcPhysicalQuantity, is an abstract entity that holds a complex or simple quantity measure together with a semantic definition of the usage for the single or several measure value.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcphysicalquantity.htm" + }, + "IfcPhysicalSimpleQuantity": { + "attributes": { + "Unit": "Optional assignment of a unit. If no unit is given, then the global unit assignment, as established at the IfcProject, applies to the quantity measures." + }, + "description": "The physical quantity, IfcPhysicalSimpleQuantity, is an entity that holds a single quantity measure value (as defined at the subtypes of IfcPhysicalSimpleQuantity) together with a semantic definition of the usage for the measure value.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcphysicalsimplequantity.htm" + }, + "IfcPile": { + "attributes": { + "ConstructionType": "Deprecated.", + "PredefinedType": "The predefined generic type of the pile according to function." + }, + "description": "A pile is a slender timber, concrete, or steel structural element, driven, jetted, or otherwise embedded on end in the ground for the purpose of supporting a load. A pile is also characterized as deep foundation, where the loads are transfered to deeper subsurface layers.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcpile.htm" + }, + "IfcPileType": { + "attributes": { + "PredefinedType": "Subtype of pile." + }, + "description": "The building element type IfcPileType defines commonly shared information for occurrences of piles. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcpiletype.htm" + }, + "IfcPipeFitting": { + "attributes": { + "PredefinedType": "" + }, + "description": "A pipe fitting is a junction or transition in a piping flow distribution system used to connect pipe segments, resulting in changes in flow characteristics to the fluid such as direction or flow rate.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpipefitting.htm" + }, + "IfcPipeFittingType": { + "attributes": { + "PredefinedType": "The type of pipe fitting." + }, + "description": "The flow fitting type IfcPipeFittingType defines commonly shared information for occurrences of pipe fittings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpipefittingtype.htm" + }, + "IfcPipeSegment": { + "attributes": { + "PredefinedType": "" + }, + "description": "A pipe segment is used to typically join two sections of a piping network.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpipesegment.htm" + }, + "IfcPipeSegmentType": { + "attributes": { + "PredefinedType": "The type of pipe segment." + }, + "description": "The flow segment type IfcPipeSegmentType defines commonly shared information for occurrences of pipe segments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpipesegmenttype.htm" + }, + "IfcPixelTexture": { + "attributes": { + "ColourComponents": "Indication whether the pixel values contain a 1, 2, 3, or 4 colour component.", + "Height": "The number of pixels in height (T) direction.", + "Pixel": "Flat list of hexadecimal values, each describing one pixel by 1, 2, 3, or 4 components.", + "Width": "The number of pixels in width (S) direction." + }, + "description": "An IfcPixelTexture provides a 2D image-based texture map as an explicit array of pixel values (list of Pixel binary attributes). In contrary to the IfcImageTexture the IfcPixelTexture holds a 2 dimensional list of pixel color (and opacity) directly, instead of referencing to an URL.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpixeltexture.htm" + }, + "IfcPlacement": { + "attributes": { + "Dim": "The space dimensionality of this class, derived from the dimensionality of the location. Location.Dim", + "Location": "The geometric position of a reference point, such as the center of a circle, of the item to be located." + }, + "description": "An IfcPlacement is an abstract supertype of placement subtypes that define the location of an item, or an entire shape representation, and provide its orientation. All placement subtypes define right-handed Cartesian coordinate systems and do not allow mirroring.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcplacement.htm" + }, + "IfcPlanarBox": { + "attributes": { + "Placement": "The _IfcAxis2Placement_ positions a local coordinate system for the definition of the rectangle. The origin of this local coordinate system serves as the lower left corner of the rectangular box. > NOTE In case of a 3D placement by _IfcAxisPlacement3D the _IfcPlanarBox_ is defined within the xy plane of the definition coordinate system._" + }, + "description": "A planar box specifies an arbitrary rectangular box and its location in a two dimensional Cartesian coordinate system. If the planar box is used within a three-dimensional coordinate system, it defines the rectangular box within the XY plane.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifcplanarbox.htm" + }, + "IfcPlanarExtent": { + "attributes": { + "SizeInX": "The extent in the direction of the x-axis.", + "SizeInY": "The extent in the direction of the y-axis." + }, + "description": "The planar extent defines the extent along the two axes of the two-dimensional coordinate system, independently of its position. If the planar extent is used within a three-dimensional coordinate system, it defines the extent along the x and y axes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifcplanarextent.htm" + }, + "IfcPlane": { + "description": "The planar surface is an unbounded surface in the direction of x and y. Bounded planar surfaces are defined by using a subtype of IfcBoundedSurface with BasisSurface being a plane.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcplane.htm" + }, + "IfcPlate": { + "attributes": { + "PredefinedType": "Predefined generic type for a plate that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcPlateType_ is assigned, providing its own _IfcPlateType.PredefinedType_." + }, + "description": "An IfcPlate is a planar and often flat part with constant thickness. A plate may carry loads between or beyond points of support, or provide stiffening. The location of the plate (being horizontal, vertical or sloped) is not relevant to its definition (in contrary to IfcWall and IfcSlab (as floor slab)).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcplate.htm" + }, + "IfcPlateStandardCase": { + "description": "The standard plate, IfcPlateStandardCase, defines a plate with certain constraints for the provision of material usage, parameters and with certain constraints for the geometric representation. The IfcPlateStandardCase handles all cases of plates, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcplatestandardcase.htm" + }, + "IfcPlateType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a planar member element from which the type required may be set." + }, + "description": "The element type IfcPlateType defines commonly shared information for occurrences of plates. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcplatetype.htm" + }, + "IfcPoint": { + "description": "The IfcPoint is the abstract generalisation of all point representations within a Cartesian coordinate system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcpoint.htm" + }, + "IfcPointOnCurve": { + "attributes": { + "BasisCurve": "The curve to which point parameter relates.", + "Dim": "The space dimensionality of this class, determined by the space dimensionality of the basis curve. BasisCurve.Dim", + "PointParameter": "The parameter value of the point location." + }, + "description": "The IfcPointOnCurve is a point defined by a parameter value of its defining curve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcpointoncurve.htm" + }, + "IfcPointOnSurface": { + "attributes": { + "BasisSurface": "The surface to which the parameter values relate.", + "Dim": "The space dimensionality of this class, determined by the space dimensionality of the basis surface. BasisSurface.Dim", + "PointParameterU": "The first parameter value of the point location.", + "PointParameterV": "The second parameter value of the point location." + }, + "description": "The IfcPointOnSurface is a point defined by two parameter value of its defining surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcpointonsurface.htm" + }, + "IfcPolyLoop": { + "attributes": { + "Polygon": "List of points defining the loop. There are no repeated points in the list." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcpolyloop.htm" + }, + "IfcPolygonalBoundedHalfSpace": { + "attributes": { + "PolygonalBoundary": "Two-dimensional ~~polyline~~ bounded curve, defined in the xy plane of the position coordinate system.", + "Position": "Definition of the position coordinate system for the bounding polyline ~~and the base surface~~." + }, + "description": "The polygonal bounded half space is a special subtype of a half space solid, where the material of the half space used in Boolean expressions is bounded by a polygonal boundary. The base surface of the half space is positioned by its normal relative to the object coordinate system (as defined at the supertype IfcHalfSpaceSolid), and its polygonal (with or without arc segments) boundary is defined in the XY plane of the position coordinate system established by the Position attribute, the subtraction body is extruded perpendicular to the XY plane of the position coordinate system, that is, into the direction of the positive Z axis defined by the Position attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcpolygonalboundedhalfspace.htm" + }, + "IfcPolygonalFaceSet": { + "attributes": { + "Closed": "Indication whether the _IfcPolygonalFaceSet_ is a closed shell or not. If omited no such information can be provided.", + "Faces": "The list of polygonal faces, with or without inner loops, that bound the faceted face set.", + "PnIndex": "The list of integers defining the locations in the _IfcCartesianPointList3D_ to obtain the point coordinates for the indices at the indexed polygonal faces. If the _PnIndex_ is not provided the indices at the indexed polygonal faces point directly into the _IfcCartesianPointList3D_." + }, + "description": "The IfcPolygonalFaceSet is a tessellated face set with all faces being bound by polygons. The planar faces are constructed by implicit polylines defined by three or more Cartesian points. Each planar face is defined by an instance of IfcIndexedPolygonalFace, or in case of faces with inner loops by IfcIndexedPolygonalFaceWithVoids.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcpolygonalfaceset.htm" + }, + "IfcPolyline": { + "attributes": { + "Points": "The points defining the polyline." + }, + "description": "The IfcPolyline is a bounded curve with only linear segments defined by a list of Cartesian points. If the first and the last Cartesian point in the list are identical, then the polyline is a closed curve, otherwise it is an open curve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcpolyline.htm" + }, + "IfcPort": { + "attributes": { + "ConnectedFrom": "Reference to a port that is connected by the objectified relationship.", + "ConnectedTo": "Reference to the port connection relationship. The relationship then refers to the other port to which this port is connected.", + "ContainedIn": "Reference to the element to port connection relationship. The relationship then refers to the element in which this port is contained." + }, + "description": "A port provides the means for an element to connect to other elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcport.htm" + }, + "IfcPostalAddress": { + "attributes": { + "AddressLines": "The postal address. > NOTE A postal address may occupy several lines (or elements) when recorded. It is expected that normal usage will incorporate relevant elements of the following address concepts: A location within a building (e.g. 3rd Floor) Building name (e.g. Interoperability House) Street number (e.g. 6400) Street name (e.g. Alliance Boulevard). Typical content of address lines may vary in different countries.", + "Country": "The name of a country.", + "InternalLocation": "An organization defined address for internal mail delivery.", + "PostalBox": "An address that is implied by an identifiable mail drop.", + "PostalCode": "The code that is used by the country's postal service.", + "Region": "The name of a region. > NOTE The counties of the United Kingdom and the states of North America are examples of regions.", + "Town": "The name of a town." + }, + "description": "This entity represents an address for delivery of paper based mail and other postal deliveries.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifcpostaladdress.htm" + }, + "IfcPreDefinedColour": { + "description": "The pre defined colour determines those qualified names which can be used to identify a colour that is in scope of the current data exchange specification (in contrary to colour specification which defines the colour directly by its colour components).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpredefinedcolour.htm" + }, + "IfcPreDefinedCurveFont": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpredefinedcurvefont.htm" + }, + "IfcPreDefinedItem": { + "attributes": { + "Name": "The string by which the pre defined item is identified. Allowable values for the string are declared at the level of subtypes." + }, + "description": "A pre defined item is a qualified name given to a style or font which is determined within the data exchange specification by convention on using the Name attribute value (in contrary to externally defined items, which are agreed by an external source).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpredefineditem.htm" + }, + "IfcPreDefinedProperties": { + "description": "The IfcPreDefinedProperties is an abstract supertype of all predefined property collections that have explicit attributes, each representing a property. Instantiable subtypes are assigned to specific characterised entities.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpredefinedproperties.htm" + }, + "IfcPreDefinedPropertySet": { + "description": "IfcPreDefinedPropertySet is a generalization of all statically defined property sets that are assigned to an object or type object. The statically or pre-defined property sets are entities with a fixed list of attributes having particular defined data types.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpredefinedpropertyset.htm" + }, + "IfcPreDefinedTextFont": { + "description": "The pre defined text font determines those qualified names which can be used for fonts that are in scope of the current data exchange specification (in contrary to externally defined text fonts). There are two choices:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpredefinedtextfont.htm" + }, + "IfcPresentationItem": { + "description": "The IfcPresentationItem is the abstract supertype of all entities used for presentation appearance definitions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifcpresentationitem.htm" + }, + "IfcPresentationLayerAssignment": { + "attributes": { + "AssignedItems": "The set of layered items, which are assigned to this layer.", + "Description": "Additional description of the layer.", + "Identifier": "An (internal) identifier assigned to the layer.", + "Name": "Name of the layer." + }, + "description": "The presentation layer assignment provides the layer name (and optionally a description and an identifier) for a collection of geometric representation items. The IfcPresentationLayerAssignment corresponds to the term \"CAD Layer\" and is used mainly for grouping and visibility control.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifcpresentationlayerassignment.htm" + }, + "IfcPresentationLayerWithStyle": { + "attributes": { + "LayerBlocked": "A logical setting, TRUE indicates that the layer is set to 'Blocked', FALSE that the layer is set to 'Not blocked', UNKNOWN that such information is not available.", + "LayerFrozen": "A logical setting, TRUE indicates that the layer is set to 'Frozen', FALSE that the layer is set to 'Not frozen', UNKNOWN that such information is not available.", + "LayerOn": "A logical setting, TRUE indicates that the layer is set to 'On', FALSE that the layer is set to 'Off', UNKNOWN that such information is not available.", + "LayerStyles": "Assignment of presentation styles to the layer to provide a default style for representation items. > NOTE In most cases the assignment of styles to a layer is restricted to an _IfcCurveStyle_ representing the layer curve colour, layer curve thickness, and layer curve type." + }, + "description": "An IfcPresentationLayerAssignmentWithStyle extends the presentation layer assignment with capabilities to define visibility control, access control and common style information.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationorganizationresource/lexical/ifcpresentationlayerwithstyle.htm" + }, + "IfcPresentationStyle": { + "attributes": { + "Name": "Name of the presentation style." + }, + "description": "The IfcPresentationStyle is an abstract generalization of style table for presentation information assigned to geometric representation items. It includes styles for curves, areas, surfaces, and text. Style information may include colour, hatching, rendering, and text fonts.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpresentationstyle.htm" + }, + "IfcPresentationStyleAssignment": { + "attributes": { + "Styles": "A set of presentation styles that are assigned to styled items." + }, + "description": "Assignment of style information to a styled item.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcpresentationstyleassignment.htm" + }, + "IfcProcedure": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a procedure from which the type required may be set." + }, + "description": "An IfcProcedure is a logical set of actions to be taken in response to an event or to cause an event to occur.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcprocedure.htm" + }, + "IfcProcedureType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a procedure from which the type required may be set." + }, + "description": "An IfcProcedureType defines a particular type of procedure that may be specified.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcproceduretype.htm" + }, + "IfcProcess": { + "attributes": { + "Identification": "An identifying designation given to a process or activity. It is the identifier at the occurrence level.", + "IsPredecessorTo": "Dependency between two activities, it refers to the subsequent activity for which this activity is the predecessor. The link between two activities can include a link type and a lag time.", + "IsSuccessorFrom": "Dependency between two activities, it refers to the previous activity for which this activity is the successor. The link between two activities can include a link type and a lag time.", + "LongDescription": "An extended description or narrative that may be provided.", + "OperatesOn": "Set of relationships to other objects, e.g. products, processes, controls, resources or actors, that are operated on by the process." + }, + "description": "IfcProcess is defined as one individual activity or event, that is ordered in time, that has sequence relationships with other processes, which transforms input in output, and may connect to other other processes through input output relationships. An IfcProcess can be an activity (or task), or an event. It takes usually place in building construction with the intent of designing, costing, acquiring, constructing, or maintaining products or other and similar tasks or procedures. Figure 1 illustrates process relationships.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcprocess.htm" + }, + "IfcProduct": { + "attributes": { + "ObjectPlacement": "Placement of the product in space, the placement can either be absolute (relative to the world coordinate system), relative (relative to the object placement of another product), or constraint (e.g. relative to grid axes). It is determined by the various subtypes of IfcObjectPlacement, which includes the axis placement information to determine the transformation for the object coordinate system.", + "ReferencedBy": "Reference to the _IfcRelAssignsToProduct_ relationship, by which other products, processes, controls, resources or actors (as subtypes of _IfcObjectDefinition_) can be related to this product.", + "Representation": "Reference to the representations of the product, being either a representation (IfcProductRepresentation) or as a special case a shape representations (IfcProductDefinitionShape). The product definition shape provides for multiple geometric representations of the shape property of the object within the same object coordinate system, defined by the object placement." + }, + "description": "The IfcProduct is an abstract representation of any object that relates to a geometric or spatial context. An IfcProduct occurs at a specific location in space if it has a geometric representation assigned. It can be placed relatively to other products, but ultimately relative to the project coordinate system. The ObjectPlacement attribute establishes the coordinate system in which all points and directions used by the geometric representation items under Representation are founded. The Representation is provided by an IfcProductDefinitionShape being either a geometric shape representation, or a topology representation (with or without underlying geometry of the topological items).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcproduct.htm" + }, + "IfcProductDefinitionShape": { + "attributes": { + "HasShapeAspects": "Reference to the shape aspect that represents part of the shape or its feature distinctively.", + "ShapeOfProduct": "The _IfcProductDefinitionShape_ shall be used to provide a representation for a single instance of _IfcProduct_." + }, + "description": "The IfcProductDefinitionShape defines all shape relevant information about an IfcProduct. It allows for multiple geometric shape representations of the same product. The shape relevant information includes:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcproductdefinitionshape.htm" + }, + "IfcProductRepresentation": { + "attributes": { + "Description": "The word or group of words that characterize the product representation. It can be used to add additional meaning to the name of the product representation.", + "Name": "The word or group of words by which the product representation is known.", + "Representations": "Contained list of representations (including shape representations). Each member defines a valid representation of a particular type within a particular representation context." + }, + "description": "IfcProductRepresentation defines a representation of a product, including its (geometric or topological) representation. A product can have zero, one or many geometric representations, and a single geometric representation can be shared among various products using mapped representations.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcproductrepresentation.htm" + }, + "IfcProfileDef": { + "attributes": { + "HasExternalReference": "Reference to external information, e.g. library, classification, or document information, which is associated with the profile.", + "HasProperties": "Additional properties of the profile, for example mechanical properties.", + "ProfileName": "Human-readable name of the profile, for example according to a standard profile table. As noted above, machine-readable standardized profile designations should be provided in _IfcExternalReference.ItemReference_.", + "ProfileType": "Defines the type of geometry into which this profile definition shall be resolved, either a curve or a surface area. In case of curve the profile should be referenced by a swept surface, in case of area the profile should be referenced by a swept area solid." + }, + "description": "IfcProfileDef is the supertype of all definitions of standard and arbitrary profiles within IFC. It is used to define a standard set of commonly used section profiles by their parameters or by their explicit curve geometry.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcprofiledef.htm" + }, + "IfcProfileProperties": { + "attributes": { + "ProfileDefinition": "Profile definition which is qualified by these properties." + }, + "description": "This is a collection of properties applicable to section profile definitions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcprofileproperties.htm" + }, + "IfcProject": { + "description": "IfcProject indicates the undertaking of some design, engineering, construction, or maintenance activities leading towards a product. The project establishes the context for information to be exchanged or shared, and it may represent a construction project but does not have to. The IfcProject's main purpose in an exchange structure is to provide the root instance and the context for all other information items included.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcproject.htm" + }, + "IfcProjectLibrary": { + "description": "An IfcProjectLibrary collects all library elements that are included within a referenced project data set.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcprojectlibrary.htm" + }, + "IfcProjectOrder": { + "attributes": { + "LongDescription": "A detailed description of the project order describing the work to be completed.", + "PredefinedType": "Predefined generic type for a project order that is specified in an enumeration. There may be a property set given specificly for the predefined types.", + "Status": "The current status of a project order.Examples of status values that might be used for a project order status include: * PLANNED * REQUESTED * APPROVED * ISSUED * STARTED * DELAYED * DONE" + }, + "description": "A project order is a directive to purchase products and/or perform work, such as for construction or facilities management.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/lexical/ifcprojectorder.htm" + }, + "IfcProjectedCRS": { + "attributes": { + "MapProjection": "Name by which the map projection is identified.", + "MapUnit": "Unit of the coordinate axes composing the map coordinate system. > NOTE Only length measures are in scope and all two or three axes of the map coordinate system shall have the same length unit.", + "MapZone": "Name by which the map zone, relating to the _MapProjection_, is identified." + }, + "description": "IfcProjectedCRS is a coordinate reference system of the map to which the map translation of the local engineering coordinate system of the construction or facility engineering project relates. The MapProjection and MapZone attributes uniquely identify the projection to the underlying geographic coordinate reference system, provided that they are well-known in the receiving application. The projected coordinate reference system is assumed to be a 2D or 3D right-handed Cartesian coordinate system, the optional MapUnit attribute can be used determine the length unit used by the map.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcprojectedcrs.htm" + }, + "IfcProjectionElement": { + "attributes": { + "PredefinedType": "Predefined generic type for a projection element that is specified in an enumeration. There may be a property set given specificly for the predefined types." + }, + "description": "The projection element is a specialization of the general feature element to represent projections applied to building elements. It represents a solid attached to any element that has physical manifestation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcprojectionelement.htm" + }, + "IfcProperty": { + "attributes": { + "Description": "Informative text to explain the property.", + "HasApprovals": "User-defined approvals for the property.", + "HasConstraints": "User-defined constraints for the property.", + "Name": "Name for this property. This label is the significant name string that defines the semantic meaning for the property.", + "PartOfComplex": "Reference to the _IfcComplexProperty_ in which the _IfcProperty_ is contained.", + "PartOfPset": "Reference to the _IfcPropertySet_ by which the _IfcProperty_ is referenced.", + "PropertyDependsOn": "The relating property on which the value of the property depends.", + "PropertyForDependance": "The property on whose value that of another property depends." + }, + "description": "IfcProperty is an abstract generalization for all types of properties that can be associated with IFC objects through the property set mechanism.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcproperty.htm" + }, + "IfcPropertyAbstraction": { + "attributes": { + "HasExternalReferences": "Reference to an external reference, e.g. library, classification, or document information, that is associated to the property definition." + }, + "description": "The IfcPropertyAbstraction is an abstract supertype of all property related entities defined as dependent resource entities within the specification. It may have an external reference to a dictionary or library that provides additional information about its definition. Instantiable subtypes have property name, value and other instance information.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertyabstraction.htm" + }, + "IfcPropertyBoundedValue": { + "attributes": { + "LowerBoundValue": "Lower bound value for the interval defining the property value. If the value is not given, it indicates an open bound (all values to be lower than or equal to _UpperBoundValue_).", + "SetPointValue": "Set point value as typically used for operational value setting.", + "Unit": "Unit for the upper and lower bound values, if not given, the default value for the measure type is used as defined by the global unit assignment at _IfcProject.UnitInContext_. The applicable unit is then selected by the underlying TYPE of the _UpperBoundValue_, _LowerBoundValue_, and _SetPointValue_)", + "UpperBoundValue": "Upper bound value for the interval defining the property value. If the value is not given, it indicates an open bound (all values to be greater than or equal to _LowerBoundValue_)." + }, + "description": "A property with a bounded value, IfcPropertyBoundedValue, defines a property object which has a maximum of two (numeric or descriptive) values assigned, the first value specifying the upper bound and the second value specifying the lower bound. It defines a property - value bound (min-max) combination for which the property Name, an optional Description, the optional UpperBoundValue with measure type, the optional LowerBoundValue with measure type, and the optional Unit is given. A set point value can be provided in addition to the upper and lower bound values for operational value setting.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertyboundedvalue.htm" + }, + "IfcPropertyDefinition": { + "attributes": { + "HasAssociations": "Reference to the relationship IfcRelAssociates and thus to those externally defined concepts, like classifications, documents, or library information, which are associated to the property definition.", + "HasContext": "" + }, + "description": "IfcPropertyDefinition defines the generalization of all characteristics (i.e. a grouping of individual properties), that may be assigned to objects. Currently, subtypes of IfcPropertyDefinition include property set occurrences, property set templates, and property templates.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertydefinition.htm" + }, + "IfcPropertyDependencyRelationship": { + "attributes": { + "DependantProperty": "The dependant property.", + "DependingProperty": "The property on which the relationship depends.", + "Expression": "Expression that further describes the nature of the dependency relation." + }, + "description": "An IfcPropertyDependencyRelationship describes an identified dependency between the value of one property and that of another.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertydependencyrelationship.htm" + }, + "IfcPropertyEnumeratedValue": { + "attributes": { + "EnumerationReference": "Enumeration from which a enumeration value has been selected. The referenced enumeration also establishes the unit of the enumeration value.", + "EnumerationValues": "Enumeration values, which shall be listed in the referenced _IfcPropertyEnumeration_, if such a reference is provided." + }, + "description": "A property with an enumerated value, IfcPropertyEnumeratedValue, defines a property object which has a value assigned that is chosen from an enumeration. It defines a property - value combination for which the property Name, an optional Description, the optional EnumerationValues with measure type and optionally an Unit is given.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertyenumeratedvalue.htm" + }, + "IfcPropertyEnumeration": { + "attributes": { + "EnumerationValues": "List of values that form the enumeration.", + "Name": "Name of this enumeration.", + "Unit": "Unit for the enumerator values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." + }, + "description": "IfcPropertyEnumeration is a collection of simple or measure values that define a prescribed set of alternatives from which 'enumeration values' are selected. This enables inclusion of enumeration values in property sets. IfcPropertyEnumeration provides a name for the enumeration as well as a list of unique (numeric or descriptive) values (that may have a measure type assigned). The entity defines the list of potential enumerators to be exchanged together (or separately) with properties of type IfcPropertyEnumeratedValue that selects their actual property values from this enumeration.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertyenumeration.htm" + }, + "IfcPropertyListValue": { + "attributes": { + "ListValues": "List of property values.", + "Unit": "Unit for the list values, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." + }, + "description": "An IfcPropertyListValue defines a property that has several (numeric or descriptive) values assigned, these values are given by an ordered list. It defines a property - list value combination for which the property Name, an optional Description, the optional ListValues with measure type and optionally an Unit is given. An IfcPropertyListValue is a list of values. The order in which values appear is significant. All list members shall be of the same type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertylistvalue.htm" + }, + "IfcPropertyReferenceValue": { + "attributes": { + "PropertyReference": "Reference to another property entity through one of the select types in the _IfcObjectReferenceSelect_.", + "UsageName": "Description of the use of the referenced value within the property. It is a descriptive text that may hold an expression or other additional information." + }, + "description": "The IfcPropertyReferenceValue allows a property value to be of type of an resource level entity. The applicable entities that can be used as value references are given by the IfcObjectReferenceSelect.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertyreferencevalue.htm" + }, + "IfcPropertySet": { + "attributes": { + "HasProperties": "Contained set of properties. For property sets defined as part of the IFC Object model, the property objects within a property set are defined as part of the standard. If a property is not contained within the set of predefined properties, its value has not been set at this time." + }, + "description": "The IfcPropertySet is a container that holds properties within a property tree. These properties are interpreted according to their name attribute. Each individual property has a significant name string. Some property sets are included in the specification of this standard and have a predefined set of properties indicated by assigning a significant name. These property sets are listed under \"property sets\" within this specification. Property sets applicable to certain objects are listed in the object specification. The naming convention \"Pset_Xxx\" applies to all those property sets that are defined as part of this specification and it shall be used as the value of the Name attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertyset.htm" + }, + "IfcPropertySetDefinition": { + "attributes": { + "DefinesOccurrence": "Reference to the relation to one or many object occurrences that are characterized by the property set definition. A single property set can be assigned to multiple object occurrences using the objectified relationship _IfcRefDefinesByProperties_.", + "DefinesType": "The type object to which the property set is assigned. The property set acts as a shared property set to all occurrences of the type object. > NOTE The relationship between the _IfcPropertySetDefinition_ and the _IfcTypeObject_ is a direct relationship, not utilizing _IfcRelDefinesByProperties_, for maintaining compatibility with earlier releases of this standard.", + "IsDefinedBy": "Relation to the property set template, via the objectified relationship _IfcRelDefinesByTemplate_, that, if given, provides the definition template for the property set or quantity set and its properties." + }, + "description": "IfcPropertySetDefinition is a generalization of all individual property sets that can be assigned to an object or type object. The property set definition can be either:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertysetdefinition.htm" + }, + "IfcPropertySetTemplate": { + "attributes": { + "ApplicableEntity": "The attribute optionally defines the data type of the applicable type or occurrence object, to which the assigned property set template can relate. If not present, no instruction is given to which type or occurrence object the property set template is applicable. The following conventions are used: * The IFC entity name of the applicable entity using the IFC naming convention, CamelCase with IFC prefix * It can be optionally followed by the predefined type after the separator \"/\" (forward slash), using upper case * If a performance history object of a particular distribution object is attributes by the property set template, then the entity name (and potentially amended by the predefined type) is expanded by adding '[PerformanceHistory]' * If one property set template is applicable to many type and/or occurrence objects, then those object names should be separate by comma \",\" forming a comma separated string. > EXAMPLE Refering to a boiler type as applicable entity would be expressed as 'IfcBoilerType', refering to a steam boiler type as applicable entity would be expressed as 'IfcBoilerType/STEAM', refering to a wall and wall standard case and a wall type would be expressed as 'IfcWall, IfcWallStandardCase, IfcWallType'. An applicable _IfcPerformanceHistory_ assigned to an occurrence or type object would be indicated by IfcBoilerType[PerformanceHistory], or respectively IfcBoilerType/STEAM[PerformanceHistory].", + "Defines": "Relation to the property sets, via the objectified relationship _IfcRelDefinesByTemplate_, that, if given, utilize the definition template.", + "HasPropertyTemplates": "Set of _IfcPropertyTemplate_'s that are defined within the scope of the _IfcPropertySetTemplate_.", + "TemplateType": "Property set type defining whether the property set is applicable to a type (subtypes of _IfcTypeObject_), to an occurrence (subtypes of _IfcObject_), or as a special case to a performance history. The attribute _ApplicableEntity_ may further refine the applicability to a single or multiple entity type(s)." + }, + "description": "IfcPropertySetTemplate defines the template for all dynamically extensible property sets represented by IfcPropertySet. The property set template is a container of property templates within a property tree. The individual property templates are interpreted according to their Name attribute and shall have no values assigned.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertysettemplate.htm" + }, + "IfcPropertySingleValue": { + "attributes": { + "NominalValue": "Value and measure type of this property. > NOTE By virtue of the defined data type, that is selected from the SELECT _IfcValue_, the appropriate unit can be found within the _IfcUnitAssignment_, defined for the project if no value for the unit attribute is given.", + "Unit": "Unit for the nominal value, if not given, the default value for the measure type (given by the TYPE of nominal value) is used as defined by the global unit assignment at IfcProject." + }, + "description": "The property with a single value IfcPropertySingleValue defines a property object which has a single (numeric or descriptive) value assigned. It defines a property - single value combination for which the property Name, an optional Description, and an optional NominalValue with measure type is provided. In addition, the default unit as specified within the project unit context can be overriden by assigning an Unit.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertysinglevalue.htm" + }, + "IfcPropertyTableValue": { + "attributes": { + "CurveInterpolation": "Interpolation of the curve between two defining and defined values that are provided. if not provided a linear interpolation is assumed.", + "DefinedUnit": "Unit for the defined values, if not given, the default value for the measure type (given by the TYPE of the defined values) is used as defined by the global unit assignment at IfcProject.", + "DefinedValues": "Defined values which are applicable for the scope as defined by the defining values.", + "DefiningUnit": "Unit for the defining values, if not given, the default value for the measure type (given by the TYPE of the defining values) is used as defined by the global unit assignment at IfcProject.", + "DefiningValues": "List of defining values, which determine the defined values. This list shall have unique values only.", + "Expression": "Expression for the derivation of defined values from the defining values, the expression is given for information only, i.e. no automatic processing can be expected from the expression." + }, + "description": "IfcPropertyTableValue is a property with a value range defined by a property object which has two lists of (numeric or descriptive) values assigned. The values specify a table with two columns. The defining values provide the first column and establish the scope for the defined values (the second column). An optional Expression attribute may give the equation used for deriving the range value, which is for information purposes only.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcpropertytablevalue.htm" + }, + "IfcPropertyTemplate": { + "attributes": { + "PartOfComplexTemplate": "Reference to a complex property templates. It should only be provided, if the _PropertyType_ of the referenced complex property template is set to COMPLEX.", + "PartOfPsetTemplate": "Reference to the _IfcPropertySetTemplate_ that defines the scope for the _IfcPropertyTemplate_. A single _IfcPropertyTemplate_ can be defined within the scope of zero, one or many _IfcPropertySetTemplate_'." + }, + "description": "The IfcPropertyTemplate is an abstract supertype comprising the templates for all dynamically extensible properties, either as an IfcComplexPropertyTemplate, or an IfcSimplePropertyTemplate. These templates determine the structure of:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertytemplate.htm" + }, + "IfcPropertyTemplateDefinition": { + "description": "IfcPropertyTemplateDefinition is a generalization of all property and property set templates. Templates define the collection, types, names, applicable measure types and units of individual properties used in a project. The property template definition can be either:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcpropertytemplatedefinition.htm" + }, + "IfcProtectiveDevice": { + "attributes": { + "PredefinedType": "" + }, + "description": "A protective device breaks an electrical circuit when a stated electric current that passes through it is exceeded.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcprotectivedevice.htm" + }, + "IfcProtectiveDeviceTrippingUnit": { + "attributes": { + "PredefinedType": "" + }, + "description": "A protective device tripping unit breaks an electrical circuit at a separate breaking unit when a stated electric current that passes through the unit is exceeded.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcprotectivedevicetrippingunit.htm" + }, + "IfcProtectiveDeviceTrippingUnitType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of protective device tripping unit types from which the type required may be set." + }, + "description": "The distribution control element type IfcProtectiveDeviceTrippingUnitType defines commonly shared information for occurrences of protective device tripping units. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcprotectivedevicetrippingunittype.htm" + }, + "IfcProtectiveDeviceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of protective device from which the type required may be set." + }, + "description": "The flow controller type IfcProtectiveDeviceType defines commonly shared information for occurrences of protective devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcprotectivedevicetype.htm" + }, + "IfcProxy": { + "attributes": { + "ProxyType": "High level (and only) semantic meaning attached to the IfcProxy, defining the basic construct type behind the Proxy, e.g. Product or Process.", + "Tag": "The tag (or label) identifier at the particular instance of a product, e.g. the serial number, or the position number. It is the identifier at the occurrence level." + }, + "description": "IfcProxy is intended to be a kind of a container for wrapping objects which are defined by associated properties, which may or may not have a geometric representation and placement in space. A proxy may have a semantic meaning, defined by the Name attribute, and property definitions, attached through the property assignment relationship, which definition may be outside of the definitions given by the current release of IFC.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcproxy.htm" + }, + "IfcPump": { + "attributes": { + "PredefinedType": "" + }, + "description": "A pump is a device which imparts mechanical work on fluids or slurries to move them through a channel or pipeline. A typical use of a pump is to circulate chilled water or heating hot water in a building services distribution system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpump.htm" + }, + "IfcPumpType": { + "attributes": { + "PredefinedType": "Defines the type of pump typically used in building services." + }, + "description": "The flow moving device type IfcPumpType defines commonly shared information for occurrences of pumps. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcpumptype.htm" + }, + "IfcQuantityArea": { + "attributes": { + "AreaValue": "Area measure value of this quantity.", + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only." + }, + "description": "IfcQuantityArea is a physical quantity that defines a derived area measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantityarea.htm" + }, + "IfcQuantityCount": { + "attributes": { + "CountValue": "Count measure value of this quantity.", + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only." + }, + "description": "IfcQuantityCount is a physical quantity that defines a derived count measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantitycount.htm" + }, + "IfcQuantityLength": { + "attributes": { + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only.", + "LengthValue": "Length measure value of this quantity." + }, + "description": "IfcQuantityLength is a physical quantity that defines a derived length measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantitylength.htm" + }, + "IfcQuantitySet": { + "description": "IfcQuantitySet is the the abstract supertype for all quantity sets attached to objects. The quantity set is a container class that holds the individual quantities within a quantity tree. These quantities are interpreted according to their name attribute and classified according to their measure type. Some quantity sets are included in the IFC specification and have a predefined set of quantities indicated by assigning a significant name. These quantity sets are listed as \"quantity sets\" within this specification. Quantity sets applicable to certain objects are listed in the object specification.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcquantityset.htm" + }, + "IfcQuantityTime": { + "attributes": { + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only.", + "TimeValue": "Time measure value of this quantity." + }, + "description": "IfcQuantityTime is an element quantity that defines a time measure to provide a property of time related to an element. It is normally given by the recipe information of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantitytime.htm" + }, + "IfcQuantityVolume": { + "attributes": { + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only.", + "VolumeValue": "Volume measure value of this quantity." + }, + "description": "IfcQuantityVolume is a physical quantity that defines a derived volume measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantityvolume.htm" + }, + "IfcQuantityWeight": { + "attributes": { + "Formula": "A formula by which the quantity has been calculated. It can be assigned in addition to the actual value of the quantity. Formulas could be mathematic calculations (like width x height), database links, or a combination. The formula is for informational purposes only.", + "WeightValue": "Mass measure value of this quantity." + }, + "description": "IfcQuantityWeight is a physical element quantity that defines a derived weight measure to provide an element's physical property. It is normally derived from the physical properties of the element under the specific measure rules given by a method of measurement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcquantityresource/lexical/ifcquantityweight.htm" + }, + "IfcRailing": { + "attributes": { + "PredefinedType": "Predefined generic types for a railing that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcRailingType_ is assigned, providing its own _IfcRailingType.PredefinedType_." + }, + "description": "The railing is a frame assembly adjacent to human circulation spaces and at some space boundaries where it is used in lieu of walls or to compliment walls. Designed to aid humans, either as an optional physical support, or to prevent injury by falling.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrailing.htm" + }, + "IfcRailingType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a railing element from which the type required may be set." + }, + "description": "The building element type IfcRailingType defines commonly shared information for occurrences of railings. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrailingtype.htm" + }, + "IfcRamp": { + "attributes": { + "PredefinedType": "Predefined generic types for a ramp that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcRampType_ is assigned, providing its own _IfcRampType.PredefinedType_." + }, + "description": "A ramp is a vertical passageway which provides a human circulation link between one floor level and another floor level at a different elevation. It may include a landing as an intermediate floor slab. A ramp normally does not include steps.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcramp.htm" + }, + "IfcRampFlight": { + "attributes": { + "PredefinedType": "Predefined generic type for a ramp flight that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcRampFlightType_ is assigned, providing its own _IfcRampFlightType.PredefinedType_." + }, + "description": "A ramp comprises a single inclined segment, or several inclined segments that are connected by a horizontal segment, refered to as a landing. A ramp flight is the single inclined segment and part of the ramp construction. In case of single flight ramps, the ramp flight and the ramp are identical.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrampflight.htm" + }, + "IfcRampFlightType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a ramp flight element from which the type required may be set." + }, + "description": "The building element type IfcRampFlightType defines commonly shared information for occurrences of ramp flights. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrampflighttype.htm" + }, + "IfcRampType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a ramp element from which the type required may be set." + }, + "description": "The building element type IfcRampType defines commonly shared information for occurrences of ramps. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcramptype.htm" + }, + "IfcRationalBSplineCurveWithKnots": { + "attributes": { + "Weights": "The array of weights associated with the control points. This is derived from the weights data. IfcListToArray(WeightsData,0,SELF\\IfcBSplineCurve.UpperIndexOnControlPoints)", + "WeightsData": "The supplied values of the weights." + }, + "description": "A rational B-spline curve with knots is a B-spline curve described in terms of control points and basic functions. It describes weights in addition to the control points defined at the supertype IfcBSplineCurve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcrationalbsplinecurvewithknots.htm" + }, + "IfcRationalBSplineSurfaceWithKnots": { + "attributes": { + "Weights": "Array (two-dimensional) of weight values constructed from the _WeightsData_. IfcMakeArrayOfArray(WeightsData,0,UUpper,0,VUpper)", + "WeightsData": "The weights associated with the control points in the rational case." + }, + "description": "A rational B-spline surface with knots is a piecewise parametric rational surface described in terms of control points, and associated weight values.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcrationalbsplinesurfacewithknots.htm" + }, + "IfcRectangleHollowProfileDef": { + "attributes": { + "InnerFilletRadius": "Inner corner radius.", + "OuterFilletRadius": "Outer corner radius.", + "WallThickness": "Thickness of the material." + }, + "description": "IfcRectangleHollowProfileDef defines a section profile that provides the defining parameters of a rectangular (or square) hollow section to be used by the swept surface geometry or the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. A square hollow section can be defined by equal values for h and b. The centre of the position coordinate system is in the profiles centre of the bounding box (for symmetric profiles identical with the centre of gravity). Normally, the longer sides are parallel to the y-axis, the shorter sides parallel to the x-axis.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcrectanglehollowprofiledef.htm" + }, + "IfcRectangleProfileDef": { + "attributes": { + "XDim": "The extent of the rectangle in the direction of the x-axis.", + "YDim": "The extent of the rectangle in the direction of the y-axis." + }, + "description": "IfcRectangleProfileDef defines a rectangle as the profile definition used by the swept surface geometry or the swept area solid. It is given by its X extent and its Y extent, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcrectangleprofiledef.htm" + }, + "IfcRectangularPyramid": { + "attributes": { + "Height": "The height of the apex above the plane of the base, measured in the direction of the placement Z axis, the _SELF\\IfcCsgPrimitive3D.Position.P[2]_.", + "XLength": "The length of the base measured along the placement X axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[1]_.", + "YLength": "The length of the base measured along the placement Y axis. It is provided by the inherited axis placement through _SELF\\IfcCsgPrimitive3D.Position.P[2]_." + }, + "description": "The IfcRectangularPyramid is a Construction Solid Geometry (CSG) 3D primitive. It is a solid with a rectangular base and a point called apex as the top. The tapers from the base to the top. The axis from the center of the base to the apex is perpendicular to the base. The inherited Position attribute defines the IfcAxisPlacement3D and provides the location and orientation of the pyramid:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcrectangularpyramid.htm" + }, + "IfcRectangularTrimmedSurface": { + "attributes": { + "BasisSurface": "Surface being trimmed.", + "U1": "First u parametric value.", + "U2": "Second u parametric value.", + "Usense": "Flag to indicate whether the direction of the first parameter of the trimmed surface agrees with or opposes the sense of u in the basis surface.", + "V1": "First v parametric value.", + "V2": "Second v parametric value.", + "Vsense": "Flag to indicate whether the direction of the second parameter of the trimmed surface agrees with or opposes the sense of v in the basis surface." + }, + "description": "The IfcRectangularTrimmedSurface is a surface created by bounding its BasisSurface along two pairs of parallel curves defined within the parametric space of the referenced surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcrectangulartrimmedsurface.htm" + }, + "IfcRecurrencePattern": { + "attributes": { + "DayComponent": "The position of the specified day in a month.", + "Interval": "An interval can be given according to the pattern type. An interval value of 2 can for instance every two days, weeks, months, years. An empty interval value is regarded as 1. The used interval values should be in a reasonable range, e.g. not 0 or <0.", + "MonthComponent": "The position of the specified month in a year.", + "Occurrences": "Defines the number of occurrences of this pattern, e.g. a weekly event might be defined to occur 5 times before it stops.", + "Position": "The position of the specified component, e.g. the 3rd (position=3) Tuesday (weekday component) in a month. A negative position value is used to define the last position of the component (-1), the next to last position (-2) etc.", + "RecurrenceType": "Defines the recurrence type that gives meaning to the used attributes and decides about possible attribute combinations, i.e. what attributes are needed to fully describe the pattern type.", + "TimePeriods": "List of time periods that are defined by a start and end time of the recurring element (day). The order of the list should reflect the sequence of the time periods.", + "WeekdayComponent": "The weekday name of the specified day in a week." + }, + "description": "IfcRecurrencePattern defines repetitive time periods on the basis of regular recurrences such as each Monday in a week, or every third Tuesday in a month. The population of the remaining attributes such as DayComponent, Position, and Interval depend on the specified recurrence type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcrecurrencepattern.htm" + }, + "IfcReference": { + "attributes": { + "AttributeIdentifier": "Optionally identifies a direct or inverse attribute within an entity such as 'MaterialLayers'. If _TypeIdentifier_ is specified and refers to an entity, the attribute must exist within the referenced entity. A null value indicates a reference to the type or entity itself, such as for indicating that the type of a value must match a specified constraint.", + "InnerReference": "Optional reference to an inner value for ENTITY, SELECT, SET, or LIST attributes. A path may be formed by linking _IfcReference_ instances together. > EXAMPLE A material layer thickness may be referenced using several instances: #1=IFCREFERENCE($,'IfcSlab','HasAssociations',#2); #2=IFCREFERENCE($,'IfcMaterialLayerSet','MaterialLayers',#3); #3=IFCREFERENCE('Core','IfcMaterialLayer','LayerThickness',$);", + "InstanceName": "Optionally identifies an instance within a collection according to name. If the instance has an attribute called 'Name', such attribute is used for comparison; otherwise the first STRING-based attribute of the entity is used. > EXAMPLE _IfcRoot_-based entities such as _IfcPropertySet_ use the _Name_ attribute; _IfcRepresentation_ entities use the _RepresentationIdentifier_ attribute.", + "ListPositions": "Optionally identifies an instance within a collection according to position starting at 1. For referencing single-level collections, this attribute contains a single member; for referencing multi-level collections, then this LIST attribute contains multiple members starting from the outer-most index.", + "TypeIdentifier": "Optional identifier of the entity or type such as 'IfcMaterialLayerSet'. For entity, type, or select-based references within a collection, this resolves the reference to such type. If omitted, the type is assumed to be the same as the declared referencing attribute. > EXAMPLE _IfcRelAssociatesMaterial_._RelatingMaterial_ may be resolved to _IfcMaterialLayerSet_." + }, + "description": "This entity is used to refer to a value of an attribute on an instance. It may refer to the value of a scalar attribute or a value within a collection-based attribute. Referenced attributes may be direct values, object references, collections, inverse object references, and inverse collections. References may be chained to form a path of object-attribute references.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstraintresource/lexical/ifcreference.htm" + }, + "IfcRegularTimeSeries": { + "attributes": { + "TimeStep": "A duration of time intervals between values.", + "Values": "The collection of time series values." + }, + "description": "In a regular time series, the data arrives predictably at predefined intervals. In a regular time series there is no need to store multiple time stamps and the algorithms for analyzing the time series are therefore significantly simpler. Using the start time provided in the supertype, the time step is used to identify the frequency of the occurrences of the list of values.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcregulartimeseries.htm" + }, + "IfcReinforcementBarProperties": { + "attributes": { + "BarCount": "The number of bars with identical nominal diameter and steel grade included in the specific reinforcement configuration.", + "BarSurface": "Indicator for whether the bar surface is plain or textured.", + "EffectiveDepth": "The effective depth, i.e. the distance of the specific reinforcement cross section area or reinforcement configuration in a row, counted from a common specific reference point. Usually the reference point is the upper surface (for beams and slabs) or a similar projection in a plane (for columns).", + "NominalBarDiameter": "The nominal diameter defining the cross-section size of the reinforcing bar. The bar diameter should be identical for all bars included in the specific reinforcement configuration.", + "SteelGrade": "The nominal steel grade defined according to local standards.", + "TotalCrossSectionArea": "The total effective cross-section area of the reinforcement of a specific steel grade." + }, + "description": "IfcReinforcementProperties defines the set of properties for a specific combination of reinforcement bar steel grade, bar type and effective depth.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcreinforcementbarproperties.htm" + }, + "IfcReinforcementDefinitionProperties": { + "attributes": { + "DefinitionType": "Descriptive type name applied to reinforcement definition properties.", + "ReinforcementSectionDefinitions": "The list of section reinforcement properties attached to the reinforcement definition properties." + }, + "description": "IfcReinforcementDefinitionProperties defines the cross section properties of reinforcement included in reinforced concrete building elements. The property set definition may be used both in conjunction with insitu and precast structures.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcementdefinitionproperties.htm" + }, + "IfcReinforcingBar": { + "attributes": { + "BarLength": "Deprecated.", + "BarSurface": "Deprecated.", + "CrossSectionArea": "The effective cross-section area of the reinforcing bar or group of bars.", + "NominalDiameter": "Deprecated.", + "PredefinedType": "The role, purpose or usage of the bar, i.e. the kind of loads and stresses it is intended to carry." + }, + "description": "A reinforcing bar is usually made of steel with manufactured deformations in the surface, and used in concrete and masonry construction to provide additional strength. A single instance of this class may represent one or many of actual rebars, for example a row of rebars.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingbar.htm" + }, + "IfcReinforcingBarType": { + "attributes": { + "BarLength": "The total length of the reinforcing bar. The total length of bended bars are calculated according to local standards with corrections for the bends.", + "BarSurface": "Indicator for whether the bar surface is plain or textured.", + "BendingParameters": "Bending shape parameters. Their meaning is defined by the bending shape code and the respective standard.", + "BendingShapeCode": "Shape code per a standard like ACI 315, ISO 3766, or a similar standard. It is presumed that a single standard for defining the bar bending is used throughout the project and that this standard is referenced from the _IfcProject_ object through the _IfcDocumentReference_ mechanism.", + "CrossSectionArea": "The effective cross-section area of the reinforcing bar.", + "NominalDiameter": "The nominal diameter defining the cross-section size of the reinforcing bar.", + "PredefinedType": "Subtype of reinforcing bar." + }, + "description": "The reinforcing element type IfcReinforcingBarType defines commonly shared information for occurrences of reinforcing bars. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingbartype.htm" + }, + "IfcReinforcingElement": { + "attributes": { + "SteelGrade": "" + }, + "description": "A reinforcing element represents bars, wires, strands, meshes, tendons, and other components embedded in concrete in such a manner that the reinforcement and the concrete act together in resisting forces.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingelement.htm" + }, + "IfcReinforcingElementType": { + "description": "The element component type IfcReinforcingElementType defines commonly shared information for occurrences of reinforcing elements. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingelementtype.htm" + }, + "IfcReinforcingMesh": { + "attributes": { + "LongitudinalBarCrossSectionArea": "Deprecated.", + "LongitudinalBarNominalDiameter": "Deprecated.", + "LongitudinalBarSpacing": "Deprecated.", + "MeshLength": "Deprecated.", + "MeshWidth": "Deprecated.", + "PredefinedType": "Kind of mesh.", + "TransverseBarCrossSectionArea": "Deprecated.", + "TransverseBarNominalDiameter": "Deprecated.", + "TransverseBarSpacing": "Deprecated." + }, + "description": "A reinforcing mesh is a series of longitudinal and transverse wires or bars of various gauges, arranged at right angles to each other and welded at all points of intersection; usually used for concrete slab reinforcement. It is also known as welded wire fabric. In scope are plane meshes as well as bent meshes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingmesh.htm" + }, + "IfcReinforcingMeshType": { + "attributes": { + "BendingParameters": "If this mesh type is bent rather than planar, this attribute provides bending shape parameters. Their meaning is defined by the bending shape code and the respective standard.", + "BendingShapeCode": "If this mesh type is bent rather than planar, this attribute provides a shape code per a standard like ACI 315, ISO 3766, or a similar standard. It is presumed that a single standard for defining the mesh bending is used throughout the project and that this standard is referenced from the _IfcProject_ object through the _IfcDocumentReference_ mechanism.", + "LongitudinalBarCrossSectionArea": "The effective cross-section area of the longitudinal bars of the mesh.", + "LongitudinalBarNominalDiameter": "The nominal diameter denoting the cross-section size of the longitudinal bars.", + "LongitudinalBarSpacing": "The spacing between the longitudinal bars. Note: an even distribution of bars is presumed; other cases are handled by classification or property sets.", + "MeshLength": "The overall length of the mesh measured in its longitudinal direction.", + "MeshWidth": "The overall width of the mesh measured in its transversal direction.", + "PredefinedType": "Subtype of reinforcing mesh.", + "TransverseBarCrossSectionArea": "The effective cross-section area of the transverse bars of the mesh.", + "TransverseBarNominalDiameter": "The nominal diameter denoting the cross-section size of the transverse bars.", + "TransverseBarSpacing": "The spacing between the transverse bars. Note: an even distribution of bars is presumed; other cases are handled by classification or property sets." + }, + "description": "The reinforcing element type IfcReinforcingMeshType defines commonly shared information for occurrences of reinforcing meshs. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcreinforcingmeshtype.htm" + }, + "IfcRelAggregates": { + "attributes": { + "RelatedObjects": "The object definitions, either object occurrences or object types, that are being aggregated. They are defined as the parts in the whole/part relationship. No order is implied between the parts.", + "RelatingObject": "The object definition, either an object type or an object occurrence, that represents the aggregation. It is the whole within the whole/part relationship." + }, + "description": "The aggregation relationship IfcRelAggregates is a special type of the general composition/decomposition (or whole/part) relationship IfcRelDecomposes. The aggregation relationship can be applied to all subtypes of IfcObjectDefinition.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelaggregates.htm" + }, + "IfcRelAssigns": { + "attributes": { + "RelatedObjects": "Related objects, which are assigned to a single object. The type of the single (or relating) object is defined in the subtypes of IfcRelAssigns.", + "RelatedObjectsType": "Particular type of the assignment relationship. It can constrain the applicable object types, used within the role of _RelatedObjects_." + }, + "description": "The assignment relationship, IfcRelAssigns, is a generalization of \"link\" relationships among instances of IfcObject and its various 1^st^ level subtypes. A link denotes the specific association through which one object (the client) applies the services of other objects (the suppliers), or through which one object may navigate to other objects.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassigns.htm" + }, + "IfcRelAssignsToActor": { + "attributes": { + "ActingRole": "Role of the actor played within the context of the assignment to the object(s).", + "RelatingActor": "Reference to the information about the actor. It comprises the information about the person or organization and its addresses." + }, + "description": "The objectified relationship IfcRelAssignsToActor handles the assignment of objects (subtypes of IfcObject) to an actor (subtypes of IfcActor).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstoactor.htm" + }, + "IfcRelAssignsToControl": { + "attributes": { + "RelatingControl": "Reference to the _IfcControl_ that applies a control upon objects." + }, + "description": "The objectified relationship IfcRelAssignsToControl handles the assignment of a control (represented by subtypes of IfcControl) to other objects (represented by subtypes of IfcObject, with the exception of controls).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstocontrol.htm" + }, + "IfcRelAssignsToGroup": { + "attributes": { + "RelatingGroup": "Reference to group that contains all assigned group members." + }, + "description": "The objectified relationship IfcRelAssignsToGroup handles the assignment of object definitions (individual object occurrences as subtypes of IfcObject, and object types as subtypes of IfcTypeObject) to a group (subtypes of IfcGroup).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstogroup.htm" + }, + "IfcRelAssignsToGroupByFactor": { + "attributes": { + "Factor": "Factor provided as a ratio measure that identifies the fraction or weighted factor that applies to the group assignment." + }, + "description": "The objectified relationship IfcRelAssignsToGroupByFactor is a specialization of the general grouping mechanism. It allows to add a factor to define the ratio that applies to the assignment of object definitions (individual object occurrences as subtypes of IfcObject and object types as subtypes of IfcTypeObject) to a group (subtypes of IfcGroup).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstogroupbyfactor.htm" + }, + "IfcRelAssignsToProcess": { + "attributes": { + "QuantityInProcess": "Quantity of the object specific for the operation by this process.", + "RelatingProcess": "Reference to the process to which the objects are assigned to." + }, + "description": "The objectified relationship IfcRelAssignsToProcess handles the assignment of one or many objects to a process or activity. An object can be a product that is the item the process operates on. Processes and activities can operate on things other than products, and can operate in ways other than input and output.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstoprocess.htm" + }, + "IfcRelAssignsToProduct": { + "attributes": { + "RelatingProduct": "Reference to the product or product type to which the objects are assigned to." + }, + "description": "The objectified relationship IfcRelAssignsToProduct handles the assignment of objects (subtypes of IfcObject) to a product (subtypes of IfcProduct). The Name attribute should be used to classify the usage of the IfcRelAssignsToProduct objectified relationship. The following Name values are proposed:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstoproduct.htm" + }, + "IfcRelAssignsToResource": { + "attributes": { + "RelatingResource": "Reference to the resource to which the objects are assigned to." + }, + "description": "The objectified relationship IfcRelAssignsToResource handles the assignment of objects (as subtypes of IfcObject), acting as a resource usage or consumption, to a resource (as subtypes of IfcResource).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassignstoresource.htm" + }, + "IfcRelAssociates": { + "attributes": { + "RelatedObjects": "Set of object or property definitions to which the external references or information is associated. It includes object and type objects, property set templates, property templates and property sets and contexts." + }, + "description": "The association relationship IfcRelAssociates refers to sources of information (most notably a classification, library, document, approval, contraint, or material). The information associated may reside internally or externally of the project data. There is no dependency implied by the association.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassociates.htm" + }, + "IfcRelAssociatesApproval": { + "attributes": { + "RelatingApproval": "Reference to approval that is being applied using this relationship." + }, + "description": "The entity IfcRelAssociatesApproval is used to apply approval information defined by IfcApproval, in IfcApprovalResource schema, to subtypes of IfcRoot.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccontrolextension/lexical/ifcrelassociatesapproval.htm" + }, + "IfcRelAssociatesClassification": { + "attributes": { + "RelatingClassification": "Classification applied to the objects." + }, + "description": "The objectified relationship IfcRelAssociatesClassification handles the assignment of a classification item (items of the select IfcClassificationSelect) to objects occurrences (subtypes of IfcObject) or object types (subtypes of IfcTypeObject).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassociatesclassification.htm" + }, + "IfcRelAssociatesConstraint": { + "attributes": { + "Intent": "The intent of the constraint usage with regard to its related IfcConstraint and IfcObjects, IfcPropertyDefinitions or IfcRelationships. Typical values can be e.g. RATIONALE or EXPECTED PERFORMANCE.", + "RelatingConstraint": "Reference to constraint that is being applied using this relationship." + }, + "description": "The entity IfcRelAssociatesConstraint is used to apply constraint information defined by IfcConstraint, in the IfcConstraintResource schema, to subtypes of IfcRoot.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifccontrolextension/lexical/ifcrelassociatesconstraint.htm" + }, + "IfcRelAssociatesDocument": { + "attributes": { + "RelatingDocument": "Document information or reference which is applied to the objects." + }, + "description": "The objectified relationship (IfcRelAssociatesDocument) handles the assignment of a document information (items of the select IfcDocumentSelect) to objects occurrences (subtypes of IfcObject) or object types (subtypes of IfcTypeObject).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassociatesdocument.htm" + }, + "IfcRelAssociatesLibrary": { + "attributes": { + "RelatingLibrary": "Reference to a library, from which the definition of the property set is taken." + }, + "description": "The objectified relationship (IfcRelAssociatesLibrary) handles the assignment of a library item (items of the select IfcLibrarySelect) to subtypes of IfcObjectDefinition or IfcPropertyDefinition.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelassociateslibrary.htm" + }, + "IfcRelAssociatesMaterial": { + "attributes": { + "RelatingMaterial": "Material definition assigned to the elements or element types." + }, + "description": "IfcRelAssociatesMaterial is an objectified relationship between a material definition and elements or element types to which this material definition applies.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelassociatesmaterial.htm" + }, + "IfcRelConnects": { + "description": "IfcRelConnects is a connectivity relationship that connects objects under some criteria. As a general connectivity it does not imply constraints, however subtypes of the relationship define the applicable object types for the connectivity relationship and the semantics of the particular connectivity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelconnects.htm" + }, + "IfcRelConnectsElements": { + "attributes": { + "ConnectionGeometry": "The geometric shape representation of the connection geometry that is provided in the object coordinate system of the _RelatingElement_ (mandatory) and in the object coordinate system of the _RelatedElement_ (optionally).", + "RelatedElement": "Reference to a subtype of _IfcElement_ that is connected by the connection relationship in the role of _RelatedElement_.", + "RelatingElement": "Reference to a subtype of _IfcElement_ that is connected by the connection relationship in the role of _RelatingElement_." + }, + "description": "The IfcRelConnectsElements objectified relationship provides the generalization of the connectivity between elements. It is a 1 to 1 relationship. The concept of two elements being physically or logically connected is described independently from the connecting elements. The connectivity may be related to the shape representation of the connected entities by providing a connection geometry.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelconnectselements.htm" + }, + "IfcRelConnectsPathElements": { + "attributes": { + "RelatedConnectionType": "Indication of the connection type in relation to the path of the _RelatingObject_.", + "RelatedPriorities": "Overriding priorities at this connection. It overrides the standard priority given at the wall layer provided by _IfcMaterialLayer_._Priority_. The list of _RelatedProperties_ corresponds to the list of _IfcMaterialLayerSet_._MaterialLayers_ of the element referenced by _RelatedObject_.", + "RelatingConnectionType": "Indication of the connection type in relation to the path of the _RelatingObject_.", + "RelatingPriorities": "Overriding priorities at this connection. It overrides the standard priority given at the wall layer provided by _IfcMaterialLayer_._Priority_. The list of _RelatingProperties_ corresponds to the list of _IfcMaterialLayerSet_._MaterialLayers_ of the element referenced by _RelatingObject_." + }, + "description": "The IfcRelConnectsPathElements relationship provides the connectivity information between two elements, which have path information.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrelconnectspathelements.htm" + }, + "IfcRelConnectsPortToElement": { + "attributes": { + "RelatedElement": "Reference to an _IfcDistributionElement_ that has ports assigned.", + "RelatingPort": "Reference to an Port that is connected by the objectified relationship." + }, + "description": "IfcRelConnectsPortToElement is a relationship between a distribution element and dynamically connected ports where connections are realised to other distribution elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelconnectsporttoelement.htm" + }, + "IfcRelConnectsPorts": { + "attributes": { + "RealizingElement": "Defines the element that realizes a port connection relationship.", + "RelatedPort": "Reference to the second port that is connected by the objectified relationship.", + "RelatingPort": "Reference to the first port that is connected by the objectified relationship." + }, + "description": "An IfcRelConnectsPorts relationship defines the relationship that is made between two ports at their point of connection. It may include the connection geometry between two ports.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelconnectsports.htm" + }, + "IfcRelConnectsStructuralActivity": { + "attributes": { + "RelatedStructuralActivity": "Reference to a structural activity which is acting upon the specified structural item or element.", + "RelatingElement": "Reference to a structural item or element to which the specified activity is applied." + }, + "description": "The IfcRelConnectsStructuralActivity relationship connects a structural activity (either an action or reaction) to a structural member, structural connection, or element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcrelconnectsstructuralactivity.htm" + }, + "IfcRelConnectsStructuralMember": { + "attributes": { + "AdditionalConditions": "Describes additional connection properties.", + "AppliedCondition": "Conditions which define the connections properties. Connection conditions are often called \"release\" but are not only used to define mechanisms like hinges but also rigid, elastic, and other conditions.", + "ConditionCoordinateSystem": "Defines a coordinate system used for the description of the connection properties in _ConnectionCondition_ relative to the local coordinate system of _RelatingStructuralMember_. If left unspecified, the placement _IfcAxis2Placement3D_((x,y,z), ?, ?) is implied with x,y,z being the local member coordinates where the connection is made and the default axes directions being in parallel with the local axes of _RelatingStructuralMember_.", + "RelatedStructuralConnection": "Reference to an instance of IfcStructuralConnection (or its subclasses) which is connected to the specified structural member.", + "RelatingStructuralMember": "Reference to an instance of IfcStructuralMember (or its subclasses) which is connected to the specified structural connection.", + "SupportedLength": "Defines the 'supported length' of this structural connection. See Fig. for more detail." + }, + "description": "The entity IfcRelConnectsStructuralMember defines all needed properties describing the connection between structural members and structural connection objects (nodes or supports).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcrelconnectsstructuralmember.htm" + }, + "IfcRelConnectsWithEccentricity": { + "attributes": { + "ConnectionConstraint": "The connection constraint explicitly states the eccentricity between a structural member and a structural connection by means of two topological objects (vertex and vertex, or edge and edge, or face and face)." + }, + "description": "The entity IfcRelConnectsWithEccentricity adds the definition of eccentricity to the connection between a structural member and a structural connection (representing either a node or support).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcrelconnectswitheccentricity.htm" + }, + "IfcRelConnectsWithRealizingElements": { + "attributes": { + "ConnectionType": "The type of the connection given for informal purposes, it may include labels, like 'joint', 'rigid joint', 'flexible joint', etc.", + "RealizingElements": "Defines the elements that realize a connection relationship." + }, + "description": "IfcRelConnectsWithRealizingElements defines a generic relationship that is made between two elements that require the realization of that relationship by means of further realizing elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelconnectswithrealizingelements.htm" + }, + "IfcRelContainedInSpatialStructure": { + "attributes": { + "RelatedElements": "Set of products, which are contained within this level of the spatial structure hierarchy.", + "RelatingStructure": "Spatial structure element, within which the element is contained. Any element can only be contained within one element of the project spatial structure." + }, + "description": "This objectified relationship, IfcRelContainedInSpatialStructure, is used to assign elements to a certain level of the spatial project structure. Any element can only be assigned once to a certain level of the spatial structure. The question, which level is relevant for which type of element, can only be answered within the context of a particular project and might vary within the various regions.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelcontainedinspatialstructure.htm" + }, + "IfcRelCoversBldgElements": { + "attributes": { + "RelatedCoverings": "Relationship to the set of coverings that are assigned to this element.", + "RelatingBuildingElement": "Relationship to the element that is covered. It includes building elements for coverings such as flooring or cladding, or distribution elements for coverings such as sleeving or wrapping." + }, + "description": "The IfcRelCoversBldgElements relationship is an objectified relationship between an element and one to many coverings, which cover that element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrelcoversbldgelements.htm" + }, + "IfcRelCoversSpaces": { + "attributes": { + "RelatedCoverings": "Relationship to the set of coverings covering that cover surfaces of this space.", + "RelatingSpace": "Relationship to the space object that is covered." + }, + "description": "The objectified relationship, IfcRelCoversSpace, relates a space object to one or many coverings, which faces (or is assigned to) the space.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrelcoversspaces.htm" + }, + "IfcRelDeclares": { + "attributes": { + "RelatedDefinitions": "Set of object or property definitions that are assigned to a context and to which the unit and representation context definitions of that context apply.", + "RelatingContext": "Reference to the _IfcProject_ to which additional information is assigned." + }, + "description": "The objectified relationship IfcRelDeclares handles the declaration of objects (subtypes of IfcObject) or properties (subtypes of IfcPropertyDefinition) to a project or project library (represented by IfcProject, or IfcProjectLibrary).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldeclares.htm" + }, + "IfcRelDecomposes": { + "description": "The decomposition relationship, IfcRelDecomposes, defines the general concept of elements being composed or decomposed. The decomposition relationship denotes a whole/part hierarchy with the ability to navigate from the whole (the composition) to the parts and vice versa.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldecomposes.htm" + }, + "IfcRelDefines": { + "description": "A generic and abstract relationship which subtypes are used to:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldefines.htm" + }, + "IfcRelDefinesByObject": { + "attributes": { + "RelatedObjects": "Objects being part of an object occurrence decomposition, acting as the \"reflecting parts\" in the relationship.", + "RelatingObject": "Object being part of an object type decomposition, acting as the \"declaring part\" in the relationship." + }, + "description": "The objectified relationship IfcRelDefinesByObject defines the relationship between an object taking part in an object type decomposition and an object occurrences taking part in an occurrence decomposition of that type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldefinesbyobject.htm" + }, + "IfcRelDefinesByProperties": { + "attributes": { + "RelatedObjects": "Reference to the objects (or single object) to which the property definition applies.", + "RelatingPropertyDefinition": "Reference to the property set definition for that object or set of objects." + }, + "description": "The objectified relationship IfcRelDefinesByProperties defines the relationships between property set definitions and objects. Properties are aggregated in property sets. Property sets can be either directly assigned to occurrence objects using this relationship, or assigned to an object type and assigned via that type to occurrence objects. The assignment of an IfcPropertySet to an IfcTypeObject is not handled via this objectified relationship, but through the direct relationship HasPropertySets at IfcTypeObject.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldefinesbyproperties.htm" + }, + "IfcRelDefinesByTemplate": { + "attributes": { + "RelatedPropertySets": "One or many property sets or quantity sets that obtain their definitions from the single property set template.", + "RelatingTemplate": "Property set template that provides the common definition of related property sets." + }, + "description": "The objectified relationship IfcRelDefinesByTemplate defines the relationships between property set template and property sets. Common information about property sets, e.g. the applicable name, description, contained properties, is defined by the property set template and assigned to all property sets.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldefinesbytemplate.htm" + }, + "IfcRelDefinesByType": { + "attributes": { + "RelatedObjects": "", + "RelatingType": "Reference to the type (or style) information for that object or set of objects." + }, + "description": "The objectified relationship IfcRelDefinesByType defines the relationship between an object type and object occurrences. The IfcRelDefinesByType is a 1-to-N relationship, as it allows for the assignment of one type information to a single or to many objects. Those objects then share the same object type, and the property sets and properties assigned to the object type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcreldefinesbytype.htm" + }, + "IfcRelFillsElement": { + "attributes": { + "RelatedBuildingElement": "Reference to ~~building~~ element that occupies fully or partially the associated opening.", + "RelatingOpeningElement": "Opening Element being filled by virtue of this relationship." + }, + "description": "IfcRelFillsElement is an objectified relationship between an opening element and an element that fills (or partially fills) the opening element. It is an one-to-one relationship.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelfillselement.htm" + }, + "IfcRelFlowControlElements": { + "attributes": { + "RelatedControlElements": "References control elements which may be used to impart control on the Distribution Element.", + "RelatingFlowElement": "Relationship to a distribution flow element" + }, + "description": "This objectified relationship between a distribution flow element occurrence and one-to-many control element occurrences indicates that the control element(s) sense or control some aspect of the flow element. It is applied to IfcDistributionFlowElement and IfcDistributionControlElement.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/lexical/ifcrelflowcontrolelements.htm" + }, + "IfcRelInterferesElements": { + "attributes": { + "ImpliedOrder": "Logical value indicating whether the interference geometry should be subtracted from the _RelatingElement_ (if TRUE), or whether it should be either subtracted from the _RelatingElement_ or the _RelatedElement_ (if FALSE), or whether no indication can be provided (if UNKNOWN).", + "InterferenceGeometry": "The geometric shape representation of the interference geometry that is provided in the object coordinate system of the _RelatingElement_ (mandatory) and in the object coordinate system of the _RelatedElement_ (optionally).", + "InterferenceType": "Optional identifier that describes the nature of the interference. Examples could include 'Clash', 'ProvisionForVoid', etc.", + "RelatedElement": "Reference to a subtype of _IfcElement that is the _RelatedElement_ in the interference relationship. Depending on the value of _ImpliedOrder_ the _RelatedElement_ may carry the notion to be the element from which the interference geometry should not be subtracted._", + "RelatingElement": "Reference to a subtype of _IfcElement that is the _RelatingElement_ in the interference relationship. Depending on the value of _ImpliedOrder_ the _RelatingElement_ may carry the notion to be the element from which the interference geometry should be subtracted._" + }, + "description": "The IfcRelInterferesElements objectified relationship indicates that two elements interfere. Interference is a spatial overlap between the two elements. It is a 1 to 1 relationship. The concept of two elements interfering physically or logically is described independently from the elements. The interference may be related to the shape representation of the entities by providing an interference geometry.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelinterfereselements.htm" + }, + "IfcRelNests": { + "attributes": { + "RelatedObjects": "The object definitions, either non-product object occurrences or non-product object types, that are being nestes. They are defined as the parts in the ordered whole/part relationship - i.e. there is an implied order among the parts expressed by the position within the list of _RelatedObjects_.", + "RelatingObject": "The object definition, either an non-product object type or a non-product object occurrence, that represents the nest. It is the whole within the whole/part relationship." + }, + "description": "The nesting relationship IfcRelNests is a special type of the general composition/decomposition (or whole/part) relationship IfcRelDecomposes. The nesting relationship can be applied to all non physical subtypes of object and object types, namely processes, controls (like cost items), and resources. It can also be applied to physical subtypes of object and object types, namely elements having ports. The nesting implies an order among the nested parts.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelnests.htm" + }, + "IfcRelProjectsElement": { + "attributes": { + "RelatedFeatureElement": "Reference to the _IfcFeatureElementAddition_ that defines an addition to the volume of the element, by using a Boolean addition operation. An example is a projection at the associated element.", + "RelatingElement": "Element at which a projection is created by the associated _IfcProjectionElement_." + }, + "description": "The IfcRelProjectsElement is an objectified relationship between an element and one projection element that creates a modifier to the shape of the element. The relationship is defined to be a 1:1 relationship, if an element has more than one projection, several relationship objects have to be used, each pointing to a different projection element. The IfcRelProjectsElement establishes an aggregation relationship between the main element and a sub ordinary addition feature.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelprojectselement.htm" + }, + "IfcRelReferencedInSpatialStructure": { + "attributes": { + "RelatedElements": "Set of products, which are referenced within this level of the spatial structure hierarchy. > NOTE Referenced elements are contained elsewhere within the spatial structure, they are referenced additionally by this spatial structure element, e.g., because they span several stories.", + "RelatingStructure": "Spatial structure element, within which the element is referenced. Any element can be contained within zero, one or many elements of the project spatial and zoning structure." + }, + "description": "The objectified relationship, IfcRelReferencedInSpatialStructure is used to assign elements in addition to those levels of the project spatial structure, in which they are referenced, but not primarily contained.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelreferencedinspatialstructure.htm" + }, + "IfcRelSequence": { + "attributes": { + "RelatedProcess": "Reference to the process, that is the successor.", + "RelatingProcess": "Reference to the process, that is the predecessor.", + "SequenceType": "The way in which the time lag applies to the sequence.", + "TimeLag": "Time duration of the sequence, it is the time lag between the predecessor and the successor as specified by the SequenceType.", + "UserDefinedSequenceType": "Allows for specification of user defined type of the sequence beyond the enumeration values (START_START, START_FINISH, FINISH_START, FINISH_FINISH) provided by _SequenceType_ attribute of type _IfcSequenceEnum_. When a value is provided for attribute _UserDefinedSequenceType_ in parallel the attribute _SequenceType_ shall have enumeration value USERDEFINED." + }, + "description": "IfcRelSequence is a sequential relationship between processes where one process must occur before the other in time and where the timing of the relationship may be described as a type of sequence. The relating process (IfcRelSequence.RelatingProcess) is considered to be the predecessor in the relationship (has precedence) whilst the related process (IfcRelSequence.RelatedProcess) is the successor.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcrelsequence.htm" + }, + "IfcRelServicesBuildings": { + "attributes": { + "RelatedBuildings": "Spatial structure elements (including site, building, storeys) that are serviced by the system.", + "RelatingSystem": "System that services the Buildings." + }, + "description": "The IfcRelServicesBuildings is an objectified relationship that defines the relationship between a system and the sites, buildings, storeys, spaces, or spatial zones, it serves. Examples of systems are:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelservicesbuildings.htm" + }, + "IfcRelSpaceBoundary": { + "attributes": { + "ConnectionGeometry": "Physical representation of the space boundary. Provided as a **curve or** surface given within the LCS of the space.", + "InternalOrExternalBoundary": "Defines, whether the Space Boundary is internal (Internal), or external, i.e. adjacent to open space (that can be an partially enclosed space, such as terrace (External).", + "PhysicalOrVirtualBoundary": "Defines, whether the Space Boundary is physical (Physical) or virtual (Virtual).", + "RelatedBuildingElement": "Reference to ~~Building~~ Element, that defines the Space Boundaries.", + "RelatingSpace": "Reference to one spaces that is delimited by this boundary." + }, + "description": "The space boundary defines the physical or virtual delimiter of a space by the relationship IfcRelSpaceBoundary to the surrounding elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelspaceboundary.htm" + }, + "IfcRelSpaceBoundary1stLevel": { + "attributes": { + "InnerBoundaries": "Reference to the inner boundaries of the space boundary. Inner boundaries are defined by the space boundaries of openings, doors and windows.", + "ParentBoundary": "Reference to the host, or parent, space boundary within which this inner boundary is defined." + }, + "description": "The 1st level space boundary defines the physical or virtual delimiter of a space by the relationship IfcRelSpaceBoundary1stLevel to the surrounding elements. 1st level space boundaries are characterizeda by:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelspaceboundary1stlevel.htm" + }, + "IfcRelSpaceBoundary2ndLevel": { + "attributes": { + "CorrespondingBoundary": "Reference to the other space boundary of the pair of two space boundaries on either side of a space separating thermal boundary element.", + "Corresponds": "Reference to the other space boundary of the pair of two space boundaries on either side of a space separating thermal boundary element." + }, + "description": "The 2nd level space boundary defines the physical or virtual delimiter of a space by the relationship IfcRelSpaceBoundary2ndLevel to the surrounding elements. 2nd level space boundaries are characterized by:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelspaceboundary2ndlevel.htm" + }, + "IfcRelVoidsElement": { + "attributes": { + "RelatedOpeningElement": "Reference to the feature subtraction element which defines a void in the associated element.", + "RelatingBuildingElement": "Reference to element in which a void is created by associated feature subtraction element." + }, + "description": "IfcRelVoidsElement is an objectified relationship between a building element and one opening element that creates a void in the element. It is a one-to-one relationship. This relationship implies a Boolean operation of subtraction between the geometric bodies of the element and the opening.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcrelvoidselement.htm" + }, + "IfcRelationship": { + "description": "IfcRelationship is the abstract generalization of all objectified relationships in IFC. Objectified relationships are the preferred way to handle relationships among objects. This allows to keep relationship specific properties directly at the relationship and opens the possibility to later handle relationship specific behavior.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcrelationship.htm" + }, + "IfcReparametrisedCompositeCurveSegment": { + "attributes": { + "ParamLength": "" + }, + "description": "The IfcReparametrisedCompositeCurveSegment is geometrically identical to a IfcCompositeCurveSegment but with the additional capability of reparametrization.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcreparametrisedcompositecurvesegment.htm" + }, + "IfcRepresentation": { + "attributes": { + "ContextOfItems": "Definition of the representation context for which the different subtypes of representation are valid.", + "Items": "Set of geometric representation items that are defined for this representation.", + "LayerAssignments": "Assignment of the whole representation to a single or multiple layer(s). The _LayerAssigments_ can be overridden by _LayerAssigments_ of the _IfcRepresentationItem_'s within the list of _Items_. > NOTE Implementation agreements can restrict the maximum number of layer assignments to 1.", + "OfProductRepresentation": "Reference to the product representations to which this individual representation applies. In most cases it is the reference to one or many product shapes, to which this shape representation is applicable.", + "RepresentationIdentifier": "The optional identifier of the representation as used within a project.", + "RepresentationMap": "Use of the representation within an _IfcRepresentationMap_. If used, this _IfcRepresentation_ may be assigned to many representations as one of its _Items_ using an _IfcMappedItem_. Using _IfcRepresentationMap_ is the way to share one representation (often of type _IfcShapeRepresentation_) by many products.", + "RepresentationType": "The description of the type of a representation context. The representation type defines the type of geometry or topology used for representing the product representation. More information is given at the subtypes _IfcShapeRepresentation_ and _IfcTopologyRepresentation_. The supported values for context type are to be specified by implementers agreements." + }, + "description": "The IfcRepresentation defines the general concept of representing product properties and in particular the product shape.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcrepresentation.htm" + }, + "IfcRepresentationContext": { + "attributes": { + "ContextIdentifier": "The optional identifier of the representation context as used within a project.", + "ContextType": "The description of the type of a representation context. The supported values for context type are to be specified by implementers agreements.", + "RepresentationsInContext": "All shape representations that are defined in the same representation context." + }, + "description": "The IfcRepresentationContext defines the context to which the IfcRepresentation of a product is related.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcrepresentationcontext.htm" + }, + "IfcRepresentationItem": { + "attributes": { + "LayerAssignment": "Assignment of the representation item to a single or multiple layer(s). The _LayerAssignments_ can override a _LayerAssignments_ of the _IfcRepresentation_ it is used within the list of _Items_.", + "StyledByItem": "Reference to the _IfcStyledItem_ that provides presentation information to the representation, e.g. a curve style, including colour and thickness to a geometric curve." + }, + "description": "The IfcRepresentationItem is used within an IfcRepresentation (directly or indirectly through other IfcRepresentationItem's) to represent an IfcProductRepresentation. Most commonly these IfcRepresentationItem's are geometric or topological representation items, that can (but not need to) have presentation style infomation assigned.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcrepresentationitem.htm" + }, + "IfcRepresentationMap": { + "attributes": { + "HasShapeAspects": "Reference to the shape aspect that represents part of the shape or its feature distinctively.", + "MapUsage": "", + "MappedRepresentation": "A representation that is mapped to at least one mapped item.", + "MappingOrigin": "An axis2 placement that defines the position about which the mapped representation is mapped." + }, + "description": "An IfcRepresentationMap defines the base definition (also referred to as block, cell or macro) called MappedRepresentation within the MappingOrigin. The MappingOrigin defines the coordinate system in which the MappedRepresentation is defined.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcrepresentationmap.htm" + }, + "IfcResource": { + "attributes": { + "Identification": "An identifying designation given to a resource. It is the identifier at the occurrence level.", + "LongDescription": "A detailed description of the resource (e.g. the skillset for a labor resource).", + "ResourceOf": "Set of relationships to other objects, e.g. products, processes, controls, resources or actors, for which this resource object is a resource." + }, + "description": "IfcResource contains the information needed to represent the costs, schedule, and other impacts from the use of a thing in a process. It is not intended to use IfcResource to model the general properties of the things themselves, while an optional linkage from IfcResource to the things to be used can be specified (specifically, the relationship from subtypes of IfcResource to IfcProduct through the IfcRelAssignsToResource relationship).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcresource.htm" + }, + "IfcResourceApprovalRelationship": { + "attributes": { + "RelatedResourceObjects": "Resource objects that are approved.", + "RelatingApproval": "The approval for the resource objects selected." + }, + "description": "An IfcResourceApprovalRelationship is used for associating an approval to resource objects. A single approval might be given to one or many items via IfcResourceObjectSelect.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcapprovalresource/lexical/ifcresourceapprovalrelationship.htm" + }, + "IfcResourceConstraintRelationship": { + "attributes": { + "RelatedResourceObjects": "The properties to which a constraint is to be related.", + "RelatingConstraint": "The constraint that is to be related." + }, + "description": "An IfcResourceConstraintRelationship is a relationship entity that enables a constraint to be related to one or more resource level objects.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstraintresource/lexical/ifcresourceconstraintrelationship.htm" + }, + "IfcResourceLevelRelationship": { + "attributes": { + "Description": "A description that may apply additional information about the relationship.", + "Name": "A name used to identify or qualify the relationship." + }, + "description": "IfcResourceLevelRelationship is an abstract base entity for relationships between resource-level entities.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcexternalreferenceresource/lexical/ifcresourcelevelrelationship.htm" + }, + "IfcResourceTime": { + "attributes": { + "ActualFinish": "Indicates the time when the resource actually finished working.", + "ActualStart": "Indicates the time when the resource actually started working.", + "ActualUsage": "Indicates the actual amount of the resource used concurrently.", + "ActualWork": "Indicates the actual work performed by the resource as of the StatusTime.", + "Completion": "Indicates the percent completion of this resource. If the resource is assigned to a task, then indicates completion of the task on behalf of the resource; if the resource is partitioned into sub-allocations, then indicates overall completion of sub-allocations.", + "IsOverAllocated": "Indicates that the resource is scheduled in excess of its capacity.", + "LevelingDelay": "Indicates a delay in the ScheduleStart caused by leveling.", + "RemainingUsage": "", + "RemainingWork": "Indicates the work remaining to be completed by the resource.", + "ScheduleContour": "Indicates how a resource should be leveled over time by adjusting the resource usage according to a specified curve. Standard values include: 'Flat', 'BackLoaded', 'FrontLoaded', 'DoublePeak', 'EarlyPeak', 'LatePeak', 'Bell', and 'Turtle'. Custom values may specify a custom name or formula.", + "ScheduleFinish": "Indicates the time when the resource is scheduled to finish working.", + "ScheduleStart": "Indicates the time when the resource is scheduled to start working.", + "ScheduleUsage": "Indicates the amount of the resource used concurrently. For example, 100% means 1 worker, 300% means 3 workers, 50% means half of 1 worker's time for scenarios where multitasking is feasible. If not provided, then the usage ratio is considered to be 100%.", + "ScheduleWork": "Indicates the total work (e.g. person-hours) allocated to the task on behalf of the resource. Note: this is not necessarily the same as the task duration (IfcTaskTime.ScheduleDuration); it may vary according to the resource usage ratio and other resources assigned to the task.", + "StatusTime": "Indicates the date and time for which status values are applicable; particularly completion, actual, and remaining values. If values are time-phased (the referencing IfcConstructionResource has associated time series values for attributes), then the status values may be determined from such time-phased data as of the StatusTime." + }, + "description": "IfcResourceTime captures the time-related information about a construction resource.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcresourcetime.htm" + }, + "IfcRevolvedAreaSolid": { + "attributes": { + "Angle": "The angle through which the sweep will be made. This angle is measured from the plane of the swept area provided by the XY plane of the position coordinate system.", + "Axis": "Axis about which revolution will take place.", + "AxisLine": "The line of the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(Axis.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(Axis.Z,1.0))" + }, + "description": "An IfcRevolvedAreaSolid is a solid created by revolving a cross section provided by a profile definition about an axis.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcrevolvedareasolid.htm" + }, + "IfcRevolvedAreaSolidTapered": { + "attributes": { + "EndSweptArea": "" + }, + "description": "IfcRevolvedAreaSolidTapered is defined by revolving a cross section along a circular arc. The cross section may change along the revolving sweep from the shape of the start cross section into the shape of the end cross section. Corresponding vertices of the start and end cross sections are then connected. The bounded surface may have holes which will sweep into holes in the solid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcrevolvedareasolidtapered.htm" + }, + "IfcRightCircularCone": { + "attributes": { + "BottomRadius": "The radius of the cone at the base.", + "Height": "The distance between the base of the cone and the apex." + }, + "description": "The IfcRightCircularCone is a Construction Solid Geometry (CSG) 3D primitive. It is a solid with a circular base and a point called apex as the top. The tapers from the base to the top. The axis from the center of the circular base to the apex is perpendicular to the base. The inherited Position attribute defines the IfcAxisPlacement3D and provides the location and orientation of the cone:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcrightcircularcone.htm" + }, + "IfcRightCircularCylinder": { + "attributes": { + "Height": "The distance between the planar circular faces of the cylinder.", + "Radius": "The radius of the cylinder." + }, + "description": "The IfcRightCircularCylinder is a Construction Solid Geometry (CSG) 3D primitive. It is a solid with a circular base and top. The cylindrical surface between if formed by points at a fixed distance from the axis of the cylinder. The inherited Position attribute defines the IfcAxisPlacement3D and provides:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcrightcircularcylinder.htm" + }, + "IfcRoof": { + "attributes": { + "PredefinedType": "Predefined generic types for a roof that are specified in an enumeration. There may be a property set given for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcRoofType_ is assigned, providing its own _IfcRoofType.PredefinedType_." + }, + "description": "A roof is the covering of the top part of a building, it protects the building against the effects of wheather.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcroof.htm" + }, + "IfcRoofType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a roof element from which the type required may be set." + }, + "description": "The building element type IfcRoofType defines commonly shared information for occurrences of roofs. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcrooftype.htm" + }, + "IfcRoot": { + "attributes": { + "Description": "Optional description, provided for exchanging informative comments.", + "GlobalId": "Assignment of a globally unique identifier within the entire software world.", + "Name": "Optional name for use by the participating software systems or users. For some subtypes of IfcRoot the insertion of the Name attribute may be required. This would be enforced by a where rule.", + "OwnerHistory": "Assignment of the information about the current ownership of that object, including owning actor, application, local identification and information captured about the recent changes of the object, > NOTE only the last modification in stored - either as addition, deletion or modification." + }, + "description": "IfcRoot is the most abstract and root class for all entity definitions that roots in the kernel or in subsequent layers of the IFC specification. It is therefore the common supertype of all IFC entities, beside those defined in an IFC resource schema. All entities that are subtypes of IfcRoot can be used independently, whereas resource schema entities, that are not subtypes of IfcRoot, are not supposed to be independent entities.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcroot.htm" + }, + "IfcRoundedRectangleProfileDef": { + "attributes": { + "RoundingRadius": "Radius of the circular arcs by which all four corners of the rectangle are equally rounded." + }, + "description": "IfcRoundedRectangleProfileDef defines a rectangle with equally rounded corners as the profile definition used by the swept surface geometry or the swept area solid. It is given by the X extent, the Y extent, and the radius for the rounded corners, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system, that is, in the center of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcroundedrectangleprofiledef.htm" + }, + "IfcSIUnit": { + "attributes": { + "Dimensions": "The dimensional exponents of SI units are derived by function _IfcDimensionsForSiUnit_. IfcDimensionsForSiUnit (SELF.Name)", + "Name": "The word, or group of words, by which the SI unit is referred to. > NOTE Even though the SI system's base unit for mass is kilogram, the _IfcSIUnit_ for mass is gram if no _Prefix_ is asserted.", + "Prefix": "The SI Prefix for defining decimal multiples and submultiples of the unit." + }, + "description": "The IfcSIUnit covers both standard base SI units such as meter and second, and derived SI units such as Pascal, square meter and cubic meter.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcsiunit.htm" + }, + "IfcSanitaryTerminal": { + "attributes": { + "PredefinedType": "" + }, + "description": "A sanitary terminal is a fixed appliance or terminal usually supplied with water and used for drinking, cleaning or foul water disposal or that is an item of equipment directly used with such an appliance or terminal.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcsanitaryterminal.htm" + }, + "IfcSanitaryTerminalType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of sanitary terminal from which the type required may be set." + }, + "description": "The flow terminal type IfcSanitaryTerminalType defines commonly shared information for occurrences of sanitary terminals. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcsanitaryterminaltype.htm" + }, + "IfcSchedulingTime": { + "attributes": { + "DataOrigin": "Specifies the origin of the scheduling time entity. It currently differentiates between predicted, simulated, measured, and user defined values.", + "Name": "Optional name for the time definition.", + "UserDefinedDataOrigin": "Value of the data origin if DataOrigin attribute is USERDEFINED." + }, + "description": "IfcSchedulingTime is the abstract supertype of entities that capture time-related information of processes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcschedulingtime.htm" + }, + "IfcSeamCurve": { + "description": "An IfcSeamCurve is a 3-dimensional curve that has additional representations provided by exactly two distinct pcurves describing the same curve at the two extreme ends of a closed parametric surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcseamcurve.htm" + }, + "IfcSectionProperties": { + "attributes": { + "EndProfile": "The cross section profile at the end point of the longitudinal section.", + "SectionType": "An indicator whether a specific piece of a cross section is uniform or tapered in longitudinal direction.", + "StartProfile": "The cross section profile at the start point of the longitudinal section." + }, + "description": "IfcSectionProperties defines the cross section properties for a single longitudinal piece of a cross section. It is a special-purpose helper class for IfcSectionReinforcementProperties.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcsectionproperties.htm" + }, + "IfcSectionReinforcementProperties": { + "attributes": { + "CrossSectionReinforcementDefinitions": "The set of reinforcment properties attached to a section reinforcement properties definition.", + "LongitudinalEndPosition": "The end position in longitudinal direction for the section reinforcement properties.", + "LongitudinalStartPosition": "The start position in longitudinal direction for the section reinforcement properties.", + "ReinforcementRole": "The role, purpose or usage of the reinforcement, i.e. the kind of loads and stresses it is intended to carry, defined for the section reinforcement properties.", + "SectionDefinition": "Definition of the cross section profile and longitudinal section type.", + "TransversePosition": "The position for the section reinforcement properties in transverse direction." + }, + "description": "IfcSectionReinforcementProperties defines the cross section properties of reinforcement for a single longitudinal piece of a cross section with a specific reinforcement usage type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcsectionreinforcementproperties.htm" + }, + "IfcSectionedSpine": { + "attributes": { + "CrossSectionPositions": "Position coordinate systems for the cross sections that form the sectioned spine. The profiles defining the cross sections are positioned within the xy plane of the corresponding position coordinate system.", + "CrossSections": "A list of at least two cross sections, each defined within the xy plane of the position coordinate system of the cross section. The position coordinate system is given by the corresponding list CrossSectionPositions.", + "Dim": "The dimensionality of the spine curve is always 3. 3", + "SpineCurve": "A single composite curve, that defines the spine curve. Each of the composite curve segments correspond to the part between two cross-sections." + }, + "description": "An IfcSectionedSpine is a representation of the shape of a three dimensional object composed by a number of planar cross sections, and a spine curve. The shape is defined between the first element of cross sections and the last element of the cross sections. A sectioned spine may be used to represent a surface or a solid but the interpolation of the shape between the cross sections is not defined.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsectionedspine.htm" + }, + "IfcSensor": { + "attributes": { + "PredefinedType": "" + }, + "description": "A sensor is a device that measures a physical quantity and converts it into a signal which can be read by an observer or by an instrument.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcsensor.htm" + }, + "IfcSensorType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of sensor from which the type required may be set." + }, + "description": "The distribution control element type IfcSensorType defines commonly shared information for occurrences of sensors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcsensortype.htm" + }, + "IfcShadingDevice": { + "attributes": { + "PredefinedType": "Predefined generic type for a shading device that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcShadingDeviceType_ is assigned, providing its own _IfcShadingDeviceType.PredefinedType_." + }, + "description": "Shading devices are purpose built devices to protect from the sunlight, from natural light, or screening them from view. Shading devices can form part of the facade or can be mounted inside the building, they can be fixed or operable.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcshadingdevice.htm" + }, + "IfcShadingDeviceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a shading device element from which the type required may be set." + }, + "description": "The building element type IfcShadingDeviceType defines commonly shared information for occurrences of shading devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcshadingdevicetype.htm" + }, + "IfcShapeAspect": { + "attributes": { + "Description": "The word or group of words that characterize the shape aspect. It can be used to add additional meaning to the name of the aspect.", + "Name": "The word or group of words by which the shape aspect is known. It is a tag to indicate the particular semantic of a component within the product definition shape, used to provide meaning. Example: use the tag \"Glazing\" to define which component of a window shape defines the glazing area.", + "PartOfProductDefinitionShape": "Reference to the _IfcProductDefinitionShape_ or the _IfcRepresentationMap_ of which this shape is an aspect.", + "ProductDefinitional": "An indication that the shape aspect is on the physical boundary of the product definition shape. If the value of this attribute is TRUE, it shall be asserted that the shape aspect being identified is on such a boundary. If the value is FALSE, it shall be asserted that the shape aspect being identified is not on such a boundary. If the value is UNKNOWN, it shall be asserted that it is not known whether or not the shape aspect being identified is on such a boundary. --- EXAMPLE: Would be FALSE for a center line, identified as shape aspect; would be TRUE for a cantilever. ---", + "ShapeRepresentations": "List of ~~shape~~ representations. Each member defines a valid representation of a particular type within a particular representation context as being an aspect (or part) of a product definition." + }, + "description": "IfcShapeAspect allows for grouping of shape representation items that represent aspects (or components) of the shape of a product. Thereby shape representations of components of the product shape represent a distinctive part to a product that can be explicitly addressed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcshapeaspect.htm" + }, + "IfcShapeModel": { + "attributes": { + "OfShapeAspect": "Reference to the shape aspect, for which it is the shape representation." + }, + "description": "IfcShapeModel represents the concept of a particular geometric and/or topological representation of a product's shape or a product component's shape within a representation context. This representation context has to be a geometric representation context (with the exception of topology representations without associated geometry). The two subtypes are IfcShapeRepresentation to cover geometric models that represent a shape, and IfcTopologyRepresentation to cover the conectivity of a product or product component. The topology may or may not have geometry associated.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcshapemodel.htm" + }, + "IfcShapeRepresentation": { + "description": "The IfcShapeRepresentation represents the concept of a particular geometric representation of a product or a product component within a specific geometric representation context. The inherited attribute RepresentationType is used to define the geometric model used for the shape representation (e.g. 'SweptSolid', or 'Brep'), the inherited attribute RepresentationIdentifier is used to denote the kind of the representation captured by the IfcShapeRepresentation (e.g. 'Axis', 'Body', etc.).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcshaperepresentation.htm" + }, + "IfcShellBasedSurfaceModel": { + "attributes": { + "Dim": "The space dimensionality of this class, it is always 3. 3", + "SbsmBoundary": "" + }, + "description": "An IfcShellBasedSurfaceModel represents the shape by a set of open or closed shells. The connected faces within the shell have a dimensionality 2 and are placed in a coordinate space of dimensionality 3.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcshellbasedsurfacemodel.htm" + }, + "IfcSimpleProperty": { + "description": "IfcSimpleProperty is a generalization of a single property object. The various subtypes of IfcSimpleProperty establish different ways in which a property value can be set.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpropertyresource/lexical/ifcsimpleproperty.htm" + }, + "IfcSimplePropertyTemplate": { + "attributes": { + "AccessState": "Information about the access state of the property. It determines whether a property be viewed and/or modified by any receiving application without specific knowledge of it. **Attribute use definition for _IfcStateEnum_*** READWRITE: Properties of this template are readable and writable. They may be viewed and modified by users of any application. These are typical informational properties set by a user. * READONLY: Properties of this template are read-only. They may be viewed but not modified by users of any application. (Applications may generate such values). These are typical automatically generated properties that should be displayed only, but not written back. * LOCKED: Properties of this template are locked. They may only be accessed by the owning application (the publisher of the property set template). These are typically application depended, internal properties that should not be published. * READWRITELOCKED: Properties of this template are locked, readable, and writable. They may only be accessed by the owning application. * READONLYLOCKED: Properties of this template are locked and read-only. They may only be accessed by the owning application.", + "Enumerators": "Name of the property enumeration, and list of all valid enumerators being selectable values, assigned to the definition of the property. This attribute shall only be provided, if the _PropertyType_ is set to: * P_ENUMERATEDVALUE", + "Expression": "The expression used to store additional information for the property template depending on the _PropertyType_. It should the following definitions, if the _PropertyType_ is set to: * P_TABLEVALUE: the expression that could be evaluated to define the correlation between the defining values and the defined values. * Q_LENGTH, Q_AREA, Q_VOLUME, Q_COUNT, Q_WEIGTH, Q_TIME: the formula to be used to calculate the quantity > NOTE No value shall be asserted if the _PropertyType_ is not listed above.", + "PrimaryMeasureType": "Primary measure type assigned to the definition of the property. It should be provided, if the _PropertyType_ is set to: * P_SINGLEVALUE: determining the measure type of _IfcPropertySingleValue.NominalValue_ * P_ENUMERATEDVALUE: determining the measure type of _IfcPropertyEnumeratedValue.EnumerationValues_ * P_BOUNDEDVALUE: determining the measure type of _IfcPropertyBoundedValue.LowerBoundValue_ * P_LISTVALUE: determining the measure type of _IfcPropertyListValue.ListValues_ * P_TABLEVALUE: determining the measure type of _IfcPropertyTableValue.DefiningValues_ * P_REFERENCEVALUE: determining the measure type of _IfcPropertyTableValue.PropertyReference_ > NOTE The value range of the measure type is within the select type _IfcValue_ for all _PropertyType_'s with the exeption of P_REFERENCEVALUE. Here it is within the select type _IfcObjectReferenceSelect_.", + "PrimaryUnit": "Primary unit assigned to the definition of the property. It should be provided, if the _PropertyType_ is set to: * P_SINGLEVALUE: determining the _IfcPropertySingleValue.Unit_ * P_ENUMERATEDVALUE: determining the _IfcPropertyEnumeration.Unit_ * P_BOUNDEDVALUE: determining the _IfcPropertyBoundedValue.Unit_ * P_LISTVALUE: determining the _IfcPropertyListValue.Unit_ * P_TABLEVALUE: determining the _IfcPropertyTableValue.DefiningUnit_", + "SecondaryMeasureType": "Secondary measure type assigned to the definition of the property. It should be provided, if the _PropertyType_ is set to: * P_BOUNDEDVALUE: determining the measure type of _IfcPropertyBoundedValue.UpperBoundValue_ * P_TABLEVALUE: determining the measure type of _IfcPropertyTableValue.DefinedValues_ The value range of the measure type is within the select type _IfcValue_ for all _PropertyType_'s with the exeption of P_ENUMERATEDVALUE. Here it is the comma delimited list of enumerators. > NOTE The measure type of _IfcPropertyEnumeration.EnumerationValues_ is provided as _PrimaryDataType_.", + "SecondaryUnit": "Secondary unit assigned to the definition of the property. It should be provided, if the _PropertyType_ is set to: * P_TABLEVALUE: determining the _IfcPropertyTableValue.DefinedUnit_", + "TemplateType": "Property type defining whether the property template defines a property with a single value, a bounded value, a list value, a table value, an enumerated value, or a reference value. Or the quantity type defining whether the template defines a quantity with a length, area, volume, weight or time value. > NOTE the value of this property determines the correct use of the _PrimaryUnit_, _SecondaryUnit_, _PrimaryDataType_, _SecondaryDataType_, and _Expression_ attributes." + }, + "description": "The IfcSimplePropertyTemplate defines the template for all dynamically extensible properties, either the subtypes of IfcSimpleProperty, or the subtypes of IfcPhysicalSimpleQuantity. The individual property templates are interpreted according to their Name attribute and may have a predefined template type, property units, and property measure types. The correct interpretation of the attributes:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifcsimplepropertytemplate.htm" + }, + "IfcSite": { + "attributes": { + "LandTitleNumber": "The land title number (designation of the site within a regional system).", + "RefElevation": "Datum elevation relative to sea level.", + "RefLatitude": "World Latitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > NOTE Latitudes are measured relative to the geodetic equator, north of the equator by positive values - from 0 till +90, south of the equator by negative values - from 0 till -90.", + "RefLongitude": "World Longitude at reference point (most likely defined in legal description). Defined as integer values for degrees, minutes, seconds, and, optionally, millionths of seconds with respect to the world geodetic system WGS84. > NOTE Longitudes are measured relative to the geodetic zero meridian, nominally the same as the Greenwich prime meridian: longitudes west of the zero meridian have negative values - from 0 till -180, longitudes east of the zero meridian have positive values - from 0 till -180. > EXAMPLE Chicago Harbor Light has according to WGS84 a longitude -87.35.40 (or 87.35.40W) and a latitude 41.53.30 (or 41.53.30N).", + "SiteAddress": "Address given to the site for postal purposes." + }, + "description": "A site is a defined area of land, possibly covered with water, on which the project construction is to be completed. A site may be used to erect, retrofit or turn down building(s), or for other construction related developments.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcsite.htm" + }, + "IfcSlab": { + "attributes": { + "PredefinedType": "Predefined generic type for a slab that is specified in an enumeration. There may be a property set given specifically for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcSlabType_ is assigned, providing its own _IfcSlabType.PredefinedType_." + }, + "description": "A slab is a component of the construction that normally encloses a space vertically. The slab may provide the lower support (floor) or upper construction (roof slab) in any space in a building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcslab.htm" + }, + "IfcSlabElementedCase": { + "description": "The IfcSlabElementedCase defines a slab with certain constraints for the provision of its components. The IfcSlabElementedCase handles all cases of slabs, that are decomposed into parts:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcslabelementedcase.htm" + }, + "IfcSlabStandardCase": { + "description": "The standard slab, IfcSlabStandardCase, defines a slab with certain constraints for the provision of material usage, parameters and with certain constraints for the geometric representation. The IfcSlabStandardCase handles all cases of slabs, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcslabstandardcase.htm" + }, + "IfcSlabType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a slab element from which the type required may be set." + }, + "description": "The element type IfcSlabType defines commonly shared information for occurrences of slabs. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcslabtype.htm" + }, + "IfcSlippageConnectionCondition": { + "attributes": { + "SlippageX": "Slippage in x-direction of the coordinate system defined by the instance which uses this resource object.", + "SlippageY": "Slippage in y-direction of the coordinate system defined by the instance which uses this resource object.", + "SlippageZ": "Slippage in z-direction of the coordinate system defined by the instance which uses this resource object." + }, + "description": "Describes slippage in support conditions or connection conditions. Slippage means that a relative displacement may occur in a support or connection before support or connection reactions are awoken.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcslippageconnectioncondition.htm" + }, + "IfcSolarDevice": { + "attributes": { + "PredefinedType": "" + }, + "description": "A solar device converts solar radiation into other energy such as electric current or thermal energy.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcsolardevice.htm" + }, + "IfcSolarDeviceType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The energy conversion device type IfcSolarDeviceType defines commonly shared information for occurrences of solar devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcsolardevicetype.htm" + }, + "IfcSolidModel": { + "attributes": { + "Dim": "The space dimensionality of this class, it is always 3. 3" + }, + "description": "An IfcSolidModel represents the 3D shape by different types of solid model representations. It is the common abstract supertype of Boundary representation, CSG representation, Sweeping representation and other suitable solid representation schemes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsolidmodel.htm" + }, + "IfcSpace": { + "attributes": { + "BoundedBy": "Reference to a set of _IfcRelSpaceBoundary_'s that defines the physical or virtual delimitation of that space against physical or virtual boundaries.", + "ElevationWithFlooring": "Level of flooring of this space; the average shall be taken, if the space ground surface is sloping or if there are level differences within this space.", + "HasCoverings": "Reference to _IfcCovering_ by virtue of the objectified relationship _IfcRelCoversSpaces_. It defines the concept of a space having coverings assigned. Those coverings may represent different flooring, or tiling areas. > NOTE Coverings are often managed by the space, and not by the building element, which they cover.", + "PredefinedType": "Predefined generic types for a space that are specified in an enumeration. There might be property sets defined specifically for each predefined type. > NOTE Previous use had been to indicates whether the _IfcSpace_ is an interior space by value INTERNAL, or an exterior space by value EXTERNAL. This use is now deprecated, the property 'IsExternal' at 'Pset_SpaceCommon' should be used instead." + }, + "description": "A space represents an area or volume bounded actually or theoretically. Spaces are areas or volumes that provide for certain functions within a building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspace.htm" + }, + "IfcSpaceHeater": { + "attributes": { + "PredefinedType": "" + }, + "description": "Space heaters utilize a combination of radiation and/or natural convection using a heating source such as electricity, steam or hot water to heat a limited space or area. Examples of space heaters include radiators, convectors, baseboard and finned-tube heaters.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcspaceheater.htm" + }, + "IfcSpaceHeaterType": { + "attributes": { + "PredefinedType": "Enumeration of possible types of space heater (e.g., baseboard heater, convector, radiator, etc.)." + }, + "description": "The flow terminal type IfcSpaceHeaterType defines commonly shared information for occurrences of space heaters. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcspaceheatertype.htm" + }, + "IfcSpaceType": { + "attributes": { + "LongName": "Long name for a space type, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a space type, and the _LongName_ refers to the full descriptive name.", + "PredefinedType": "Predefined types to define the particular type of space. There may be property set definitions available for each predefined type." + }, + "description": "A space represents an area or volume bounded actually or theoretically. Spaces are areas or volumes that provide for certain functions within a building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspacetype.htm" + }, + "IfcSpatialElement": { + "attributes": { + "ContainsElements": "Set of spatial containment relationships, that holds those elements, which are contained within this element of the project spatial structure. > NOTE The spatial containment relationship, established by _IfcRelContainedInSpatialStructure_, is required to be an hierarchical relationship, where each element can only be assigned to 0 or 1 spatial structure element.", + "LongName": "Long name for a spatial structure element, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a spacial element, and the _LongName_ refers to the full descriptive name.", + "ReferencesElements": "Set of spatial reference relationships, that holds those elements, which are referenced, but not contained, within this element of the project spatial structure.", + "ServicedBySystems": "Set of relationships to systems, that provides a certain service to the spatial element for which it is defined. The relationship is handled by the objectified relationship _IfcRelServicesBuildings_." + }, + "description": "A spatial element is the generalization of all spatial elements that might be used to define a spatial structure or to define spatial zones.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialelement.htm" + }, + "IfcSpatialElementType": { + "attributes": { + "ElementType": "The type denotes a particular type that indicates the object further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED." + }, + "description": "IfcSpatialElementType defines a list of commonly shared property set definitions of a spatial structure element and an optional set of product representations. It is used to define a spatial element specification (the specific element information, that is common to all occurrences of that element type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialelementtype.htm" + }, + "IfcSpatialStructureElement": { + "attributes": { + "CompositionType": "Denotes, whether the predefined spatial structure element represents itself, or an aggregate (complex) or a part (part). The interpretation is given separately for each subtype of spatial structure element. If no _CompositionType_ is asserted, the dafault value 'ELEMENT' applies." + }, + "description": "A spatial structure element is the generalization of all spatial elements that might be used to define a spatial structure. That spatial structure is often used to provide a project structure to organize a building project.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialstructureelement.htm" + }, + "IfcSpatialStructureElementType": { + "description": "The element type (IfcSpatialStructureElementType) defines a list of commonly shared property set definitions of a spatial structure element and an optional set of product representations. It is used to define an element specification (i.e. the specific element information, that is common to all occurrences of that element type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialstructureelementtype.htm" + }, + "IfcSpatialZone": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of the spatial zone. There may be property set definitions available for each predefined type." + }, + "description": "A spatial zone is a non-hierarchical and potentially overlapping decomposition of the project under some functional consideration. A spatial zone might be used to represent a thermal zone, a construction zone, a lighting zone, a usable area zone. A spatial zone might have its independent placement and shape representation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialzone.htm" + }, + "IfcSpatialZoneType": { + "attributes": { + "LongName": "Long name for a spatial zone type, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a spatial zone, and the _LongName_ refers to the full descriptive name.", + "PredefinedType": "Predefined types to define the particular type of the spatial zone. There may be property set definitions available for each predefined type." + }, + "description": "The IfcSpatialZoneType defines a list of commonly shared property set definitions of a space and an optional set of product representations. It is used to define a space specification (i.e. the specific space information, that is common to all occurrences of that space type).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcspatialzonetype.htm" + }, + "IfcSphere": { + "attributes": { + "Radius": "The radius of the sphere." + }, + "description": "The IfcSphere is a Construction Solid Geometry (CSG) 3D primitive. It is a solid where all points at the surface have the same distance from the center point. The inherited Position attribute defines the IfcAxisPlacement3D and provides:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsphere.htm" + }, + "IfcSphericalSurface": { + "attributes": { + "Radius": "The radius of the sphere." + }, + "description": "The IfcSphericalSurface is a bounded elementary surface. The inherited Position attribute defines the IfcAxisPlacement3D and provides:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsphericalsurface.htm" + }, + "IfcStackTerminal": { + "attributes": { + "PredefinedType": "" + }, + "description": "A stack terminal is placed at the top of a ventilating stack (such as to prevent ingress by birds or rainwater) or rainwater pipe (to act as a collector or hopper for discharge from guttering).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcstackterminal.htm" + }, + "IfcStackTerminalType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of stack terminal from which the type required may be set." + }, + "description": "The flow terminal type IfcStackTerminalType defines commonly shared information for occurrences of stack terminals. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcstackterminaltype.htm" + }, + "IfcStair": { + "attributes": { + "PredefinedType": "Predefined generic type for a stair that is specified in an enumeration. There may be a property set given specifically for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcStairType_ is assigned, providing its own _IfcStairType.PredefinedType_." + }, + "description": "A stair is a vertical passageway allowing occupants to walk (step) from one floor level to another floor level at a different elevation. It may include a landing as an intermediate floor slab.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcstair.htm" + }, + "IfcStairFlight": { + "attributes": { + "NumberOfRisers": "Number of the risers included in the stair flight", + "NumberOfTreads": "Number of treads included in the stair flight.", + "PredefinedType": "Predefined generic type for a stair flight that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcStairFlightType_ is assigned, providing its own _IfcStairFlightType.PredefinedType_.", + "RiserHeight": "Vertical distance from tread to tread. The riser height is supposed to be equal for all stairs in a stair flight.", + "TreadLength": "Horizontal distance from the front to the back of the tread. The tread length is supposed to be equal for all steps of the stair flight." + }, + "description": "A stair flight is an assembly of building components in a single \"run\" of stair steps (not interrupted by a landing). The stair steps and any stringers are included in the stair flight. A winder is also regarded a part of a stair flight.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcstairflight.htm" + }, + "IfcStairFlightType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a stair flight element from which the type required may be set." + }, + "description": "The building element type IfcStairFlightType defines commonly shared information for occurrences of stair flights. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcstairflighttype.htm" + }, + "IfcStairType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a stair element from which the type required may be set." + }, + "description": "The building element type IfcStairType defines commonly shared information for occurrences of stairs. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcstairtype.htm" + }, + "IfcStructuralAction": { + "attributes": { + "DestabilizingLoad": "Indicates if this action may cause a stability problem. If it is 'FALSE', no further investigations regarding stability problems are necessary." + }, + "description": "A structural action is a structural activity that acts upon a structural item or building element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralaction.htm" + }, + "IfcStructuralActivity": { + "attributes": { + "AppliedLoad": "Load or result resource object which defines the load type, direction, and load values. In case of activities which are variably distributed over curves or surfaces, _IfcStructuralLoadConfiguration_ is used which provides a list of load samples and their locations within the load distribution, measured in local coordinates of the curve or surface on which this activity acts. The contents of this load or result distribution may be further restricted by definitions at subtypes of _IfcStructuralActivity_.", + "AssignedToStructuralItem": "Reference to the _IfcRelConnectsStructuralActivity_ relationship by which activities are connected with structural items.", + "GlobalOrLocal": "Indicates whether the load directions refer to the global coordinate system (global to the analysis model, i.e. as established by _IfcStructuralAnalysisModel.SharedPlacement_) or to the local coordinate system (local to the activity or connected item, as established by an explicit or implied representation and its parameter space). > NOTE, the informal definition of _IfcRepresentationResource.IfcGlobalOrLocalEnum_ doe s not distinguish between \"global coordinate system\" and \"world coordinate system\". On the other hand, this distinction is necessary in the _IfcStructuralAnalysisDomain_ where the shared \"global\" coordinate system of an analysis model may very well not be the same as the project-wide world coordinate system. > NOTE In the scope of _IfcStructuralActivity.GlobalOrLocal_, the meaning of GLOBAL_COORDS is therefore not to be taken as world coordinate system but as the analysis model specific shared coordinate system. In contrast, LOCAL_COORDS is to be taken as coordinates which are local to individual structural items and activities, as established by subclass-specific geometry use definitions." + }, + "description": "The abstract entity IfcStructuralActivity combines the definition of actions (such as forces, displacements, etc.) and reactions (support reactions, internal forces, deflections, etc.) which are specified by using the basic load definitions from the IfcStructuralLoadResource.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralactivity.htm" + }, + "IfcStructuralAnalysisModel": { + "attributes": { + "HasResults": "References to all result groups available for this structural analysis model.", + "LoadedBy": "References to all load groups to be analyzed.", + "OrientationOf2DPlane": "If the selected model type (_PredefinedType_) describes a 2D system, the orientation defines the analysis plane (P[1], P[2]) and the normal to the analysis plane (P[3]). This is needed because structural items and activities are always defined in three-dimensional space even if they are meant to be analysed in a two-dimensional manner. * In case of predefined type IN_PLANE_LOADING_2D, the analysis is to be performed within the projection into the P[1], P[2] plane. * In case of predefined type OUT_PLANE_LOADING_2D, only the P[3] component of loads and their effects is meant to be analyzed. This is used for beam grids and for typical slab analyses. * In case of predefined type LOADING_3D, _OrientationOf2DPlane_ shall be omitted.", + "PredefinedType": "Defines the type of the structural analysis model.", + "SharedPlacement": "Object placement which shall be common to all items and activities which are grouped into this instance of _IfcStructuralAnalysisModel_. This placement establishes a coordinate system which is referred to as 'global coordinate system' in use definitions of various classes of structural items and activities. > NOTE Most commonly, but not necessarily, the _SharedPlacement_ is an _IfcLocalPlacement_ whose z axis is parallel with the z axis of the _IfcProject_'s world coordinate system and directed like the WCS z axis (i.e. pointing \"upwards\") or directed against the WCS z axis (i.e. points \"downwards\"). > NOTE Per informal proposition, this attribute is **not optional** as soon as at least one _IfcStructuralItem_ is grouped into the instance of _IfcStructuralAnalysisModel_." + }, + "description": "The IfcStructuralAnalysisModel is used to assemble all information needed to represent a structural analysis model. It encompasses certain general properties (such as analysis type), references to all contained structural members, structural supports or connections, as well as loads and the respective load results.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralanalysismodel.htm" + }, + "IfcStructuralConnection": { + "attributes": { + "AppliedCondition": "Optional boundary conditions which define support conditions of this connection object, given in local coordinate directions of the connection object. If left unspecified, the connection object is assumed to have no supports besides being connected with members.", + "ConnectsStructuralMembers": "References to the IfcRelConnectsStructuralMembers relationship by which structural members can be associated to structural connections." + }, + "description": "An IfcStructuralConnection represents a structural connection object (node connection, edge connection, or surface connection) or supports.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralconnection.htm" + }, + "IfcStructuralConnectionCondition": { + "attributes": { + "Name": "Optionally defines a name for this connection condition." + }, + "description": "Describe more rarely needed connection properties.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralconnectioncondition.htm" + }, + "IfcStructuralCurveAction": { + "attributes": { + "PredefinedType": "Type of action according to its distribution of load values.", + "ProjectedOrTrue": "Defines whether load values are given per true length of the curve on which they act, or per length of the projection of the curve in load direction. The latter is only applicable to loads which act in global coordinate directions." + }, + "description": "A structural curve action defines an action which is distributed over a curve. A curve action may be connected with a curve member or curve connection, or surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralcurveaction.htm" + }, + "IfcStructuralCurveConnection": { + "attributes": { + "Axis": "Direction which is used in the definition of the local z axis. _Axis_ is specified relative to the so-called global coordinate system, i.e. the _SELF\\IfcProduct.ObjectPlacement_. > NOTE It is desirable and usually possible that many instances of _IfcStructuralCurveConnection_ and _IfcStructuralCurveMember_ share a common instance of _IfcDirection_ as their _Axis_ attribute." + }, + "description": "Instances of IfcStructuralCurveConnection describe edge 'nodes', i.e. edges where two or more surface members are joined, or edge supports. Edge curves may be straight or curved.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralcurveconnection.htm" + }, + "IfcStructuralCurveMember": { + "attributes": { + "Axis": "Direction which is used in the definition of the local z axis. _Axis_ is specified relative to the so-called global coordinate system, i.e. the _SELF\\IfcProduct.ObjectPlacement_. > NOTE It is desirable and usually possible that many instances of _IfcStructuralCurveConnection_ and _IfcStructuralCurveMember_ share a common instance of _IfcDirection_ as their _Axis_ attribute.", + "PredefinedType": "Type of member with respect to its load carrying behavior in this analysis idealization." + }, + "description": "Instances of IfcStructuralCurveMember describe edge members, i.e. structural analysis idealizations of beams, columns, rods etc.. Curve members may be straight or curved.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralcurvemember.htm" + }, + "IfcStructuralCurveMemberVarying": { + "description": "This entity describes edge members with varying profile properties. Each instance of IfcStructuralCurveMemberVarying is composed of two or more instances of IfcStructuralCurveMember with differing profile properties. These subordinate members relate to the instance of IfcStructuralCurveMemberVarying by IfcRelAggregates.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralcurvemembervarying.htm" + }, + "IfcStructuralCurveReaction": { + "attributes": { + "PredefinedType": "Type of reaction according to its distribution of load values." + }, + "description": "This entity defines a reaction which occurs distributed over a curve. A curve reaction may be connected with a curve member or curve connection, or surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralcurvereaction.htm" + }, + "IfcStructuralItem": { + "attributes": { + "AssignedStructuralActivity": "Inverse relationship to all structural activities (i.e. to actions or reactions) which are assigned to this structural member." + }, + "description": "The abstract entity IfcStructuralItem is the generalization of structural members and structural connections, that is, analysis idealizations of elements in the building model. It defines the relation between structural members and connections with structural activities (actions and reactions).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralitem.htm" + }, + "IfcStructuralLinearAction": { + "description": "This entity defines an action with constant value which is distributed over a curve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructurallinearaction.htm" + }, + "IfcStructuralLoad": { + "attributes": { + "Name": "Optionally defines a name for this load." + }, + "description": "This abstract entity is the supertype of all loads (actions or reactions) or of certain requirements resulting from structural analysis, or certain provisions which influence structural analysis.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralload.htm" + }, + "IfcStructuralLoadCase": { + "attributes": { + "SelfWeightCoefficients": "The self weight coefficients specify ratios at which loads due to weight of members shall be included in the load case. These loads are not explicitly modeled as instances of _IfcStructuralAction_. Instead they shall be calculated according to geometry, section, and material of each member. The three components of the self weight vector correspond with the x,y,z directions of the so-called global coordinates, i.e. the directions of the shared _ObjectPlacement_ of all items in an _IfcStructuralAnalysisModel_. For example, if the object placement defines a z axis which is upright like the _IfcProject_'s world coordinate system, then the self weight coefficients would typically be [0.,0.,-1.] in a load case of dead loads with self weight. The overall coefficient in the inherited attribute _Coefficient_ shall not be applied to _SelfWeightCoefficients_ of the same instance of _IfcStructuralLoadCase_. It only applies to actions and load groups which are grouped below the load case, not to the load case's computed self weight." + }, + "description": "A load case is a load group, commonly used to group loads from the same action source.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralloadcase.htm" + }, + "IfcStructuralLoadConfiguration": { + "attributes": { + "Locations": "Locations of the load samples or result samples, given within the local coordinate system defined by the instance which uses this resource object. Each item in the list of locations pertains to the values list item at the same list index. This attribute is optional for configurations in which the locations are implicitly known from higher-level definitions.", + "Values": "List of load or result values." + }, + "description": "This class combines one or more load or result values in a 1- or 2-dimensional configuration.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadconfiguration.htm" + }, + "IfcStructuralLoadGroup": { + "attributes": { + "ActionSource": "Source of actions in the group. Normally needed if 'PredefinedType' specifies a LOAD_CASE.", + "ActionType": "Type of actions in the group. Normally needed if 'PredefinedType' specifies a LOAD_CASE.", + "Coefficient": "Load factor. If omitted, a factor is not yet known or not specified. A load factor of 1.0 shall be explicitly exported as Coefficient = 1.0.", + "LoadGroupFor": "Analysis models in which this load group is used.", + "PredefinedType": "Selects a predefined type for the load group. It can be differentiated between load groups, load cases, load combinations, or userdefined grouping levels.", + "Purpose": "Description of the purpose of this instance. Among else, possible values of the Purpose of load combinations are 'SLS', 'ULS', 'ALS' to indicate serviceability, ultimate, or accidental limit state.", + "SourceOfResultGroup": "Results which were computed using this load group." + }, + "description": "The entity IfcStructuralLoadGroup is used to structure the physical impacts. By using the grouping features inherited from IfcGroup, instances of IfcStructuralAction (or its subclasses) and of IfcStructuralLoadGroup can be used to define load groups, load cases and load combinations. (See also IfcLoadGroupTypeEnum.)", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralloadgroup.htm" + }, + "IfcStructuralLoadLinearForce": { + "attributes": { + "LinearForceX": "Linear force value in x-direction.", + "LinearForceY": "Linear force value in y-direction.", + "LinearForceZ": "Linear force value in z-direction.", + "LinearMomentX": "Linear moment about the x-axis.", + "LinearMomentY": "Linear moment about the y-axis.", + "LinearMomentZ": "Linear moment about the z-axis." + }, + "description": "An instance of the entity IfcStructuralLoadLinearForce shall be used to define actions on curves.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadlinearforce.htm" + }, + "IfcStructuralLoadOrResult": { + "description": "Abstract superclass of simple load or result classes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadorresult.htm" + }, + "IfcStructuralLoadPlanarForce": { + "attributes": { + "PlanarForceX": "Planar force value in x-direction.", + "PlanarForceY": "Planar force value in y-direction.", + "PlanarForceZ": "Planar force value in z-direction." + }, + "description": "An instance of the entity IfcStructuralLoadPlanarForce shall be used to define actions on faces.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadplanarforce.htm" + }, + "IfcStructuralLoadSingleDisplacement": { + "attributes": { + "DisplacementX": "Displacement in x-direction.", + "DisplacementY": "Displacement in y-direction.", + "DisplacementZ": "Displacement in z-direction.", + "RotationalDisplacementRX": "Rotation about the x-axis.", + "RotationalDisplacementRY": "Rotation about the y-axis.", + "RotationalDisplacementRZ": "Rotation about the z-axis." + }, + "description": "Instances of the entity IfcStructuralLoadSingleDisplacement shall be used to define displacements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadsingledisplacement.htm" + }, + "IfcStructuralLoadSingleDisplacementDistortion": { + "attributes": { + "Distortion": "The distortion curvature (warping, i.e. a cross-sectional deplanation) given to the displacement load." + }, + "description": "Defines a displacement with warping.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadsingledisplacementdistortion.htm" + }, + "IfcStructuralLoadSingleForce": { + "attributes": { + "ForceX": "Force value in x-direction.", + "ForceY": "Force value in y-direction.", + "ForceZ": "Force value in z-direction.", + "MomentX": "Moment about the x-axis.", + "MomentY": "Moment about the y-axis.", + "MomentZ": "Moment about the z-axis." + }, + "description": "Instances of the entity IfcStructuralLoadSingleForce shall be used to define the forces and moments of an action operating on a single point.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadsingleforce.htm" + }, + "IfcStructuralLoadSingleForceWarping": { + "attributes": { + "WarpingMoment": "The warping moment at the point load." + }, + "description": "Instances of the entity IfcStructuralLoadSingleForceWarping, as a subtype of IfcStructuralLoadSingleForce, shall be used to define an action operation on a single point. In addition to forces and moments defined by its supertype a warping moment can be defined.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadsingleforcewarping.htm" + }, + "IfcStructuralLoadStatic": { + "description": "The abstract entity IfcStructuralLoadStatic is the supertype of all static loads (actions or reactions) which can be defined. Within scope are single i.e. concentrated forces and moments, linear i.e. one-dimensionally distributed forces and moments, planar i.e. two-dimensionally distributed forces, furthermore displacements and temperature loads.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadstatic.htm" + }, + "IfcStructuralLoadTemperature": { + "attributes": { + "DeltaTConstant": "Temperature change which affects the complete section of the structural member, or the uniform portion of a non-uniform temperature change. > NOTE A positive value describes an increase in temperature. I.e. a positive constant temperature change causes elongation of a member, or compression in the member if there are respective restraints.", + "DeltaTY": "Non-uniform temperature change, specified as the difference of the temperature change at the outer fibre of the positive y direction minus the temperature change at the outer fibre of the negative y direction of the analysis member. > NOTE A positive non-uniform temperature change in y induces a negative curvature of the member about z, or a positive bending moment about z if there are respective restraints. y and z are local member axes.", + "DeltaTZ": "Non-uniform temperature change, specified as the difference of the temperature change at the outer fibre of the positive z direction minus the temperature change at the outer fibre of the negative z direction of the analysis member. > NOTE A positive non-uniform temperature change in z induces a positive curvature of the member about y, or a negative bending moment about y if there are respective restraints. y and z are local member axes." + }, + "description": "An instance of the entity IfcStructuralLoadTemperature shall be used to define actions which are caused by a temperature change. As shown in Figure 1, the change of temperature is given with a constant value which is applied to the complete section and values for temperature differences between outer fibres of the section.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcstructuralloadtemperature.htm" + }, + "IfcStructuralMember": { + "attributes": { + "ConnectedBy": "Inverse relationship to all structural connections (i.e. to supports or connecting elements) which are defined for this structural member." + }, + "description": "The abstract entity IfcStructuralMember is the superclass of all structural items which represent the idealized structural behavior of building elements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralmember.htm" + }, + "IfcStructuralPlanarAction": { + "description": "This entity defines an action with constant value which is distributed over a surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralplanaraction.htm" + }, + "IfcStructuralPointAction": { + "description": "This entity defines an action which acts on a point. A point action is typically connected with a point connection. It may also be connected with a curve member or curve connection, or surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralpointaction.htm" + }, + "IfcStructuralPointConnection": { + "attributes": { + "ConditionCoordinateSystem": "Defines a coordinate system used for the description of the support condition properties in _SELF\\IfcStructuralConnection.SupportCondition_, specified relative to the global coordinate system (global to the structural analysis model) established by _SELF.\\IfcProduct.ObjectPlacement_. If left unspecified, the placement _IfcAxis2Placement3D_((x,y,z), ?, ?) is implied with x,y,z being the coordinates of the reference point of this _IfcStructuralPointConnection_ and the default axes directions being in parallel with the global axes." + }, + "description": "Instances of IfcStructuralPointConnection describe structural nodes or point supports.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralpointconnection.htm" + }, + "IfcStructuralPointReaction": { + "description": "This entity defines a reaction which occurs at a point. A point reaction is typically connected with a point connection. It may also be connected with a curve member or curve connection, or surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralpointreaction.htm" + }, + "IfcStructuralReaction": { + "description": "A structural reaction is a structural activity that results from a structural action imposed to a structural item or building element. Examples are support reactions, internal forces, and deflections.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralreaction.htm" + }, + "IfcStructuralResultGroup": { + "attributes": { + "IsLinear": "This value allows to easily recognize whether a linear analysis has been applied (allowing the superposition of analysis results).", + "ResultForLoadGroup": "Reference to an instance of IfcStructuralLoadGroup for which this instance represents the result.", + "ResultGroupFor": "Reference to an instance of IfcStructuralAnalysisModel for which this instance captures a result.", + "TheoryType": "Specifies the analysis theory used to obtain the respective results." + }, + "description": "Instances of the entity IfcStructuralResultGroup are used to group results of structural analysis calculations and to capture the connection to the underlying basic load group. The basic functionality for grouping inherited from IfcGroup is used to collect instances from IfcStructuralReaction or its respective subclasses.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralresultgroup.htm" + }, + "IfcStructuralSurfaceAction": { + "attributes": { + "PredefinedType": "Type of action according to its distribution of load values.", + "ProjectedOrTrue": "Defines whether load values are given per true lengths of the surface on which they act, or per lengths of the projection of the surface in load direction. The latter is only applicable to loads which act in global coordinate directions." + }, + "description": "This entity defines an action which is distributed over a surface. A surface action may be connected with a surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfaceaction.htm" + }, + "IfcStructuralSurfaceConnection": { + "description": "Instances of IfcStructuralSurfaceConnection describe face 'nodes', i.e. faces where two or more surface members are joined, or face supports. Face surfaces may be planar or curved.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfaceconnection.htm" + }, + "IfcStructuralSurfaceMember": { + "attributes": { + "PredefinedType": "Type of member with respect to its load carrying behavior in this analysis idealization.", + "Thickness": "Defines the typically understood thickness of the structural surface member, measured normal to its reference surface." + }, + "description": "Instances of IfcStructuralSurfaceMember describe face members, that is, structural analysis idealizations of slabs, walls, and shells. Surface members may be planar or curved.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfacemember.htm" + }, + "IfcStructuralSurfaceMemberVarying": { + "description": "This entity describes surface members with varying section properties. The properties are provided by means of Pset_StructuralSurfaceMemberVaryingThickness via IfcRelDefinesByProperties, or by means of aggregation: An instance of IfcStructuralSurfaceMemberVarying may be composed of two or more instances of IfcStructuralSurfaceMember with differing section properties. These subordinate members relate to the instance of IfcStructuralSurfaceMemberVarying by IfcRelAggregates.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfacemembervarying.htm" + }, + "IfcStructuralSurfaceReaction": { + "attributes": { + "PredefinedType": "Type of reaction according to its distribution of load values." + }, + "description": "This entity defines a reaction which occurs distributed over a surface. A surface reaction may be connected with a surface member or surface connection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/lexical/ifcstructuralsurfacereaction.htm" + }, + "IfcStyleModel": { + "description": "IfcStyleModel represents the concept of a particular presentation style defined for a material (or other characteristic) of a product or a product component within a representation context. This representation context may (but has not to be) a geometric representation context.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcstylemodel.htm" + }, + "IfcStyledItem": { + "attributes": { + "Item": "A geometric representation item to which the style is assigned.", + "Name": "The word, or group of words, by which the styled item is referred to.", + "Styles": "Representation styles which are assigned, either to an geometric representation item, or to a material definition." + }, + "description": "The IfcStyledItem holds presentation style information for products, either explicitly for an IfcGeometricRepresentationItem being part of an IfcShapeRepresentation assigned to a product, or by assigning presentation information to IfcMaterial being assigned as other representation for a product.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcstyleditem.htm" + }, + "IfcStyledRepresentation": { + "description": "The IfcStyledRepresentation represents the concept of a styled presentation being a representation of a product or a product component, like material. within a representation context. This representation context does not need to be (but may be) a geometric representation context.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifcstyledrepresentation.htm" + }, + "IfcSubContractResource": { + "attributes": { + "PredefinedType": "Defines types of subcontract resources." + }, + "description": "IfcSubContractResource is a construction resource needed in a construction process that represents a sub-contractor.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcsubcontractresource.htm" + }, + "IfcSubContractResourceType": { + "attributes": { + "PredefinedType": "Defines types of subcontract resources." + }, + "description": "The resource type IfcSubContractResourceType defines commonly shared information for occurrences of subcontract resources. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/lexical/ifcsubcontractresourcetype.htm" + }, + "IfcSubedge": { + "attributes": { + "ParentEdge": "The Edge, or Subedge, which contains the Subedge." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcsubedge.htm" + }, + "IfcSurface": { + "attributes": { + "Dim": "The space dimensionality of IfcSurface. It is always a three-dimensional geometric representation item." + }, + "description": "An IfcSurface is a 2-dimensional representation item positioned in 3-dimensional space. 2-dimensional means that each point at the surface can be defined by a 2-dimensional coordinate system, usually by u and v coordinates.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsurface.htm" + }, + "IfcSurfaceCurve": { + "attributes": { + "AssociatedGeometry": "A list of one or two pcurves which define the surface or surfaces associated with the surface curve. Two elements in this list indicate that the curve has two surface associations which need not be two distinct surfaces. Being a pcurve, it also associates a basis curve in the parameter space of this surface as an alternative representation of the surface curve.", + "BasisSurface": "The surface, or surfaces on which the _IfcSurfaceCurve_ lies. This is determined from the _AssociatedGeometry_ list. IfcGetBasisSurface(SELF)", + "Curve3D": "The curve which is the three-dimensional representation of the surface curve.", + "MasterRepresentation": "The" + }, + "description": "An IfcSurfaceCurve is a 3-dimensional curve that has additional representations provided by one or two pcurves.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsurfacecurve.htm" + }, + "IfcSurfaceCurveSweptAreaSolid": { + "attributes": { + "Directrix": "The curve used to define the sweeping operation. The solid is generated by sweeping the _SELF\\IfcSweptAreaSolid.SweptArea_ along the _Directrix_.", + "EndParam": "The parameter value on the _Directrix_ at which the sweeping operation ends. If no value is provided the end of the sweeping operation is at the end of the _Directrix_.", + "ReferenceSurface": "The surface containing the _Directrix_.", + "StartParam": "The parameter value on the _Directrix_ at which the sweeping operation commences. If no value is provided the start of the sweeping operation is at the start of the _Directrix_." + }, + "description": "The IfcSurfaceCurveSweptAreaSolid is the result of sweeping an area along a directrix that lies on a reference surface. The swept area is provided by a subtype of IfcProfileDef. The profile is placed by an implicit cartesian transformation operator at the start point of the sweep, where the profile normal agrees to the tangent of the directrix at this point, and the profile's x-axis agrees to the surface normal. At any point along the directrix, the swept profile origin lies on the directrix, the profile's normal points towards the tangent of the directrix, and the profile's x-axis is identical to the surface normal at this point.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsurfacecurvesweptareasolid.htm" + }, + "IfcSurfaceFeature": { + "attributes": { + "PredefinedType": "Indicates the kind of surface feature." + }, + "description": "A surface feature is a modification at (onto, or into) of the surface of an element. Parts of the surface of the entire surface may be affected. The volume and mass of the element may be increased, remain unchanged, or be decreased by the surface feature, depending on manufacturing technology. However, any increase or decrease of volume is small compared to the total volume of the element.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcsurfacefeature.htm" + }, + "IfcSurfaceOfLinearExtrusion": { + "attributes": { + "Depth": "The depth of the extrusion, it determines the parameterization.", + "ExtrudedDirection": "The direction of the extrusion.", + "ExtrusionAxis": "The extrusion axis defined as vector. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector (ExtrudedDirection, Depth)" + }, + "description": "The IfcSurfaceOfLinearExtrusion is a surface derived by sweeping a curve along a vector.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsurfaceoflinearextrusion.htm" + }, + "IfcSurfaceOfRevolution": { + "attributes": { + "AxisLine": "The line coinciding with the axis of revolution. IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcCurve() || IfcLine(AxisPosition.Location, IfcRepresentationItem() || IfcGeometricRepresentationItem () || IfcVector(AxisPosition.Z,1.0))", + "AxisPosition": "A point on the axis of revolution and the direction of the axis of revolution." + }, + "description": "The IfcSurfaceOfRevolution is a surface derived by rotating a curve about an axis.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsurfaceofrevolution.htm" + }, + "IfcSurfaceReinforcementArea": { + "attributes": { + "ShearReinforcement": "Shear reinforcement. Specified as area per area, e.g. square metre per square metre (hence ratio measure, i.e. unitless).", + "SurfaceReinforcement1": "Reinforcement at the face of the member which is located at the side of the positive local z direction of the surface member. Specified as area per length, e.g. square metre per metre (hence length measure, e.g. metre). The reinforcement area may be specified for two or three directions of reinforcement bars.", + "SurfaceReinforcement2": "Reinforcement at the face of the member which is located at the side of the negative local z direction of the surface member. Specified as area per length, e.g. square metre per metre (hence length measure, e.g. metre). The reinforcement area may be specified for two or three directions of reinforcement bars." + }, + "description": "Describes required or provided reinforcement area of surface members.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralloadresource/lexical/ifcsurfacereinforcementarea.htm" + }, + "IfcSurfaceStyle": { + "attributes": { + "Side": "An indication of which side of the surface to apply the style.", + "Styles": "A collection of different surface styles." + }, + "description": "IfcSurfaceStyle is an assignment of one or many surface style elements to a surface, defined by subtypes of IfcSurface, IfcFaceBasedSurfaceModel, IfcShellBasedSurfaceModel, or by subtypes of IfcSolidModel. The positive direction of the surface normal relates to the positive side. In case of solids the outside of the solid is to be taken as positive side.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestyle.htm" + }, + "IfcSurfaceStyleLighting": { + "attributes": { + "DiffuseReflectionColour": "The degree of diffusion of the reflected light. In the case of specular surfaces there is no diffusion. The greater the diffusing power of the reflecting surface, the smaller the specular component of the reflected light, up to the point where only diffuse light is produced. A value of 1 means totally diffuse for that colour part of the light. > NOTE The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "DiffuseTransmissionColour": "The degree of diffusion of the transmitted light. In the case of completely transparent materials there is no diffusion. The greater the diffusing power, the smaller the direct component of the transmitted light, up to the point where only diffuse light is produced. A value of 1 means totally diffuse for that colour part of the light. > NOTE The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "ReflectanceColour": "A coefficient that determines the extent that the light falling onto a surface is fully or partially reflected. > NOTE The factor can be measured physically and has three ratios for the red, green and blue part of the light.", + "TransmissionColour": "Describes how the light falling on a body is totally or partially transmitted." + }, + "description": "IfcSurfaceStyleLighting is a container class for properties for calculation of physically exact illuminance related to a particular surface style.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestylelighting.htm" + }, + "IfcSurfaceStyleRefraction": { + "attributes": { + "DispersionFactor": "The Abbe constant given as a fixed ratio between the refractive indices of the material at different wavelengths. A low Abbe number means a high dispersive power. In general this translates to a greater angular spread of the emergent spectrum.", + "RefractionIndex": "The index of refraction for all wave lengths of light. The refraction index is the ratio between the speed of light in a vacuum and the speed of light in the medium. E.g. glass has a refraction index of 1.5, whereas water has an index of 1.33" + }, + "description": "IfcSurfaceStyleRefraction extends the surface style lighting, or the surface style rendering definition for properties for calculation of physically exact illuminance by adding seldomly used properties. Currently this includes the refraction index (by which the light ray refracts when passing through a prism) and the dispersion factor (or Abbe constant) which takes into account the wavelength dependency of the refraction.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestylerefraction.htm" + }, + "IfcSurfaceStyleRendering": { + "attributes": { + "DiffuseColour": "The diffuse part of the reflectance equation can be given as either a colour or a scalar factor. The diffuse colour field reflects all light sources depending on the angle of the surface with respect to the light source. The more directly the surface faces the light, the more diffuse light reflects. The diffuse factor field specifies how much diffuse light from light sources this surface shall reflect. Diffuse light depends on the angle of the surface with respect to the light source. The more directly the surface faces the light, the more diffuse light reflects. The diffuse colour is then defined by surface colour \\* diffuse factor.", + "DiffuseTransmissionColour": "The diffuse transmission part of the reflectance equation can be given as either a colour or a scalar factor. It only applies to materials whose Transparency field is greater than zero. The diffuse transmission colour specifies how much diffuse light is reflected at the opposite side of the material surface. The diffuse transmission factor field specifies how much diffuse light from light sources this surface shall reflect on the opposite side of the material surface. The diffuse transmissive colour is then defined by surface colour \\* diffuse transmissive factor.", + "ReflectanceMethod": "Identifies the predefined types of reflectance method from which the method required may be set.", + "ReflectionColour": "The reflection (or mirror) part of the reflectance equation can be given as either a colour or a scalar factor. Applies to \"glass\" and \"mirror\" reflection models. The reflection colour specifies the contribution made by light from the mirror direction, i.e. light being reflected from the surface. The reflection factor specifies the amount of contribution made by light from the mirror direction. The reflection colour is then defined by surface colour \\* reflection factor.", + "SpecularColour": "The specular part of the reflectance equation can be given as either a colour or a scalar factor. The specular colour determine the specular highlights (e.g., the shiny spots on an apple). When the angle from the light to the surface is close to the angle from the surface to the viewer, the specular colour is added to the diffuse and ambient colour calculations. The specular factor defines the specular part, the specular colour is then defined by surface colour \\* specular factor.", + "SpecularHighlight": "The exponent or roughness part of the specular reflectance.", + "TransmissionColour": "The transmissive part of the reflectance equation can be given as either a colour or a scalar factor. It only applies to materials which Transparency field is greater than zero. The transmissive colour field specifies the colour that passes through a transparant material (like the colour that shines through a glass). The transmissive factor defines the transmissive part, the transmissive colour is then defined by surface colour \\* transmissive factor." + }, + "description": "IfcSurfaceStyleRendering holds the properties for visualization related to a particular surface side style. It allows rendering properties to be defined by:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestylerendering.htm" + }, + "IfcSurfaceStyleShading": { + "attributes": { + "SurfaceColour": "The colour used to render the surface. The surface colour for visualisation is defined by specifying the intensity of red, green and blue.", + "Transparency": "The transparency field specifies how \"clear\" an object is, with 1.0 being completely transparent, and 0.0 completely opaque. If not given, the value 0.0 (opaque) is assumed. > NOTE The definition of 1 being transparent and 0 being opaque is the opposite of the definition in alpha channels, where 0.0 is completely transparent and 1.0 is completely opaque. This definition is due to upward compatibility to previous versions of this standard in different to the definition in _IfcIndexedColourMap_." + }, + "description": "The IfcSurfaceStyleShading allows for colour information and transparency used for shading and simple rendering. The surface colour is used for colouring or simple shading of the assigned surfaces and the transparency for identifying translucency, where 0.0 is completely opaque, and 1.0 is completely transparent.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestyleshading.htm" + }, + "IfcSurfaceStyleWithTextures": { + "attributes": { + "Textures": "The textures applied to the surface. In case of more than one surface texture is included, the _IfcSurfaceStyleWithTexture_ defines a multi texture." + }, + "description": "The entity IfcSurfaceStyleWithTextures allows to include image textures in surface styles. These image textures can be applied repeating across the surface or mapped with a particular scale upon the surface.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacestylewithtextures.htm" + }, + "IfcSurfaceTexture": { + "attributes": { + "IsMappedBy": "Texture coordinates, either provided by a corresponding list of texture vertices to vertex-based geometric items or by a texture coordinate generator, that applies the surface texture to the surfaces of the geometric items.", + "Mode": "The _Mode_ attribute is provided to control the appearance of a multi textures. The mode then controls the type of blending operation. The mode includes a MODULATE for a lit appearance, a REPLACE for a unlit appearance, and variations of the two. > NOTE The applicable values for the _Mode_ attribute are determined by view definitions or implementer agreements. It is recommended to use the modes described in ISO/IES 19775-1.2:2008 X3D Architecture and base components Edition 2, Part 1. See [18.4.3 MultiTexture](http://www.web3d.org/x3d/specifications/ISO-IEC-19775-1.2-X3D-AbstractSpecification/Part01/components/texturing.html#MultiTexture) for recommended values.", + "Parameter": "The _Parameter_ attribute is provided to control the appearance of a multi textures. The applicable parameters depend on the value of the _Mode_ attribute. > NOTE The applicable values for the list of _Parameter_ attributes are determined by view definitions or implementer agreements. It is recommended to use the source and the function fields described in ISO/IES 19775-1.2:2008 X3D Architecture and base components Edition 2, Part 1. See [18.4.3 MultiTexture](http://www.web3d.org/x3d/specifications/ISO-IEC-19775-1.2-X3D-AbstractSpecification/Part01/components/texturing.html#MultiTexture) for recommended values. > By convention, _Parameter[1]_ shall then hold the source value, _Parameter[2]_ the function value, _Parameter[3]_ the base RGB color for select operations, and _Parameter[4]_ the alpha value for select operations.", + "RepeatS": "The _RepeatS_ field specifies how the texture wraps in the S direction. If _RepeatS_ is TRUE (the default), the texture map is repeated outside the [0.0, 1.0] texture coordinate range in the S direction so that it fills the shape. If _RepeatS_ is FALSE, the texture coordinates are clamped in the S direction to lie within the [0.0, 1.0] range.", + "RepeatT": "The _RepeatT_ field specifies how the texture wraps in the T direction. If _RepeatT_ is TRUE (the default), the texture map is repeated outside the [0.0, 1.0] texture coordinate range in the T direction so that it fills the shape. If _RepeatT_ is FALSE, the texture coordinates are clamped in the T direction to lie within the [0.0, 1.0] range.", + "TextureTransform": "The _TextureTransform_ defines a 2D transformation that is applied to the texture coordinates. It affects the way texture coordinates are applied to the surfaces of geometric representation itesm. The 2D transformation supports changes to the size, orientation, and position of textures on shapes. Mirroring is not allowed to be used in the _IfcCartesianTransformationOperator_", + "UsedInStyles": "" + }, + "description": "An IfcSurfaceTexture provides a 2-dimensional image-based texture map. It can either be given by referencing an external image file through an URL reference (IfcImageTexture), including the image file as a blob (long binary) into the data set (IfcBlobTexture), or by explicitly including an array of pixels (IfcPixelTexture).", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifcsurfacetexture.htm" + }, + "IfcSweptAreaSolid": { + "attributes": { + "Position": "Position coordinate system for the resulting swept solid of the sweeping operation. The position coordinate system allows for re-positioning of the swept solid. If not provided, the swept solid remains within the position as determined by the cross section or by the directrix used for the sweeping operation.", + "SweptArea": "The surface defining the area to be swept. It is given as a profile definition within the xy plane of the position coordinate system." + }, + "description": "An IfcSweptAreaSolid represents the 3D shape by a sweeping representation scheme allowing a two dimensional planar cross section to sweep through space.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsweptareasolid.htm" + }, + "IfcSweptDiskSolid": { + "attributes": { + "Directrix": "The curve used to define the sweeping operation. The solid is generated by sweeping a circular disk along the _Directrix_.", + "EndParam": "The parameter value on the _Directrix_ at which the sweeping operation ends. If no value is provided the end of the sweeping operation is at the end of the Directrix..", + "InnerRadius": "This attribute is optional, if present it defines the radius of a circular hole in the centre of the disk.", + "Radius": "The _Radius_ of the circular disk to be swept along the _directrix_. Denotes the outer radius, if an _InnerRadius_ is applied.", + "StartParam": "The parameter value on the _Directrix_ at which the sweeping operation commences. If no value is provided the start of the sweeping operation is at the start of the Directrix.." + }, + "description": "An IfcSweptDiskSolid represents the 3D shape by a sweeping representation scheme allowing a two dimensional circularly bounded plane to sweep along a three dimensional Directrix through space.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsweptdisksolid.htm" + }, + "IfcSweptDiskSolidPolygonal": { + "attributes": { + "FilletRadius": "The fillet that is equally applied to all transitions between the segments of the _IfcPolyline_, providing the geometric representation for _the Directrix_. If omited, no fillet is applied to the segments." + }, + "description": "The IfcSweptDiskSolidPolygonal is a IfcSweptDiskSolid where the Directrix is restricted to be provided by an poly line only. An optional FilletRadius attribute can be asserted, it is then applied as a fillet to all transitions between the segments of the poly line.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifcsweptdisksolidpolygonal.htm" + }, + "IfcSweptSurface": { + "attributes": { + "Position": "Position coordinate system for the swept surface, provided by a profile definition within the XY plane of the _Position_ coordinates. If not provided, the position of the profile being swept is determined by the object coordinate system. In this case, the swept surface is not repositioned.", + "SweptCurve": "The curve to be swept in defining the surface. The curve is defined as a profile within the position coordinate system." + }, + "description": "An IfcSweptSurface is a surface defined by sweeping a curve. The swept surface is defined by a open or closed curve, represented by a subtype if IfcProfileDef, that is provided as a two-dimensional curve on an implicit plane, and by the sweeping operation.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcsweptsurface.htm" + }, + "IfcSwitchingDevice": { + "attributes": { + "PredefinedType": "" + }, + "description": "A switch is used in a cable distribution system (electrical circuit) to control or modulate the flow of electricity.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcswitchingdevice.htm" + }, + "IfcSwitchingDeviceType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of switch from which the type required may be set." + }, + "description": "The flow controller type IfcSwitchingDeviceType defines commonly shared information for occurrences of switching devices. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifcswitchingdevicetype.htm" + }, + "IfcSystem": { + "attributes": { + "ServicesBuildings": "Reference to the ~~building~~ spatial structure via the objectified relationship _IfcRelServicesBuildings_, which is serviced by the system." + }, + "description": "A system is an organized combination of related parts within an AEC product, composed for a common purpose or function or to provide a service. A system is essentially a functionally related aggregation of products. The grouping relationship to one or several instances of IfcProduct (the system members) is handled by IfcRelAssignsToGroup.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcsystem.htm" + }, + "IfcSystemFurnitureElement": { + "attributes": { + "PredefinedType": "" + }, + "description": "A system furniture element defines components of modular furniture which are not directly placed in a building structure but aggregated inside furniture.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcsystemfurnitureelement.htm" + }, + "IfcSystemFurnitureElementType": { + "attributes": { + "PredefinedType": "" + }, + "description": "The furnishing element type IfcSystemFurnitureElementType defines commonly shared information for occurrences of system furniture elements. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/lexical/ifcsystemfurnitureelementtype.htm" + }, + "IfcTShapeProfileDef": { + "attributes": { + "Depth": "Web lengths, see illustration above (= h).", + "FilletRadius": "Fillet radius according the above illustration (= r1).", + "FlangeEdgeRadius": "Edge radius according the above illustration (= r2).", + "FlangeSlope": "Slope of web of the profile.", + "FlangeThickness": "Constant wall thickness of flange (= tg).", + "FlangeWidth": "Flange lengths, see illustration above (= b).", + "WebEdgeRadius": "Edge radius according the above illustration (= r3).", + "WebSlope": "Slope of flange of the profile.", + "WebThickness": "Constant wall thickness of web (= ts)." + }, + "description": "IfcTShapeProfileDef defines a section profile that provides the defining parameters of a T-shaped section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profile's centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifctshapeprofiledef.htm" + }, + "IfcTable": { + "attributes": { + "Columns": "The column information associated with this table.", + "Name": "", + "NumberOfCellsInRow": "The number of cells in each row, this complies to the number of columns in a table. See WR2 that ensures that each row has the same number of cells. The actual value is derived from the first member of the Rows list. HIINDEX(Rows[1].RowCells)", + "NumberOfDataRows": "The number of rows in a table that contains data, i.e. total number of rows minus number of heading rows in table. SIZEOF(QUERY( Temp <* Rows | NOT(Temp.IsHeading)))", + "NumberOfHeadings": "The number of headings in a table. This is restricted by WR3 to max. one. SIZEOF(QUERY( Temp <* Rows | Temp.IsHeading))", + "Rows": "Reference to information content of rows." + }, + "description": "An IfcTable is a data structure for the provision of information in the form of rows and columns. Each instance may have IfcTableColumn instances that define the name, description and units for each column. The rows of information are stored as a list of IfcTableRow objects.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcutilityresource/lexical/ifctable.htm" + }, + "IfcTableColumn": { + "attributes": { + "Description": "The _Description_ provides human-readable text describing the table column.", + "Identifier": "The _Identifier_ identifies the column within the table. If provided, it must be unique within the table. Columns may be cross-referenced across multiple tables by sharing the same column identifier.", + "Name": "The _Name_ is a human-readable caption for the table column. It is not necessarilly unique.", + "ReferencePath": "The _ReferencePath_ indicates a relative path to the object and attribute for which data within this column is to be applied. For constraints, such path is relative to the _IfcObjectDefinition_ associated by _IfcRelAssociatesConstraint_.RelatedObjects. For a constraint to be satisified, exactly one row of the table must match the referenced object for all columns where the _ReferencePath_ attribute is set.", + "Unit": "The _Unit_ indicates the unit of measure to be used for this column's data. If not provided, then project default units are assumed. If _ReferencePath_ is provided, the the unit must be of the same measure as the referenced attribute." + }, + "description": "An IfcTableColumn is a data structure that captures column information for use in an IfcTable. Each instance defines the identifier, name, description, and units of measure that are applicable to the columnar data associated with the IfcTableRow objects.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcutilityresource/lexical/ifctablecolumn.htm" + }, + "IfcTableRow": { + "attributes": { + "IsHeading": "Flag which identifies if the row is a heading row or a row which contains row values. > NOTE - If the row is a heading, the flag takes the value = TRUE.", + "RowCells": "The data value of the table cell.." + }, + "description": "IfcTableRow contains data for a single row within an IfcTable.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcutilityresource/lexical/ifctablerow.htm" + }, + "IfcTank": { + "attributes": { + "PredefinedType": "" + }, + "description": "A tank is a vessel or container in which a fluid or gas is stored for later use.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifctank.htm" + }, + "IfcTankType": { + "attributes": { + "PredefinedType": "Defines the type of tank." + }, + "description": "The flow storage device type IfcTankType defines commonly shared information for occurrences of tanks. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifctanktype.htm" + }, + "IfcTask": { + "attributes": { + "IsMilestone": "Identifies whether a task is a milestone task (=TRUE) or not (= FALSE). > NOTE In small project planning applications, a milestone task may be understood to be a task having no duration. As such, it represents a singular point in time.", + "PredefinedType": "Identifies the predefined types of a task from which the type required may be set.", + "Priority": "A value that indicates the relative priority of the task (in comparison to the priorities of other tasks).", + "Status": "Current status of the task. > NOTE Particular values for status are not specified, these should be determined and agreed by local usage. Examples of possible status values include 'Not Yet Started', 'Started', 'Completed'.", + "TaskTime": "Time related information for the task.", + "WorkMethod": "The method of work used in carrying out a task. > NOTE This attribute should not be used if the work method is specified for the _IfcTaskType_" + }, + "description": "An IfcTask is an identifiable unit of work to be carried out in a construction project.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifctask.htm" + }, + "IfcTaskTime": { + "attributes": { + "ActualDuration": "The actual duration of the task. It is a measured value. The value is either given as elapsed time or work time, which is defined by _DurationType_.", + "ActualFinish": "The date on which a task is actually finished.", + "ActualStart": "The date on which a task is actually started. It is a measured value. > NOTE The scheduled start date must be greater than or equal to the earliest start date. No constraint is applied to the actual start date with respect to the scheduled start date since a task may be started earlier than had originally been scheduled if circumstances allow.", + "Completion": "The extent of completion expressed as a ratio or percentage. It is a measured value.", + "DurationType": "Enables to specify the type of duration values for _ScheduleDuration_, _ActualDuration_ and _RemainingTime_. The duration type is either work time or elapsed time.", + "EarlyFinish": "The earliest date on which a task can be finished. It is a calculated value.", + "EarlyStart": "The earliest date on which a task can be started. It is a calculated value.", + "FreeFloat": "The amount of time during which the start or finish of a task may be varied without any effect on the overall programme of work. It is a calculated elapsed time value.", + "IsCritical": "A flag which identifies whether a scheduled task is a critical item within the programme. > NOTE A task becomes critical when the float time becomes zero or negative.", + "LateFinish": "The latest date on which a task can be finished. It is a calculated value.", + "LateStart": "The latest date on which a task can be started. It is a calculated value.", + "RemainingTime": "The amount of time remaining to complete a task. It is a predicted value. The value is either given as elapsed time or work time, which is defined by _DurationType_. > NOTE The time remaining in which to complete a task may be determined both for tasks which have not yet started and those which have. Remaining time for a task not yet started has the same value as the scheduled duration. For a task already started, remaining time is calculated as the difference between the scheduled finish and the point of analysis.", + "ScheduleDuration": "The amount of time which is scheduled for completion of a task. The value might be measured or somehow calculated, which is defined by _ScheduleDataOrigin_. The value is either given as elapsed time or work time, which is defined by _DurationType_. > NOTE Scheduled Duration may be calculated as the time from scheduled start date to scheduled finish date.", + "ScheduleFinish": "The date on which a task is scheduled to be finished. The value might be measured or somehow calculated, which is defined by _ScheduleDataOrigin_. > NOTE The scheduled finish date must be greater than or equal to the earliest finish date.", + "ScheduleStart": "The date on which a task is scheduled to be started. The value might be measured or somehow calculated, which is defined by _ScheduleDataOrigin_. > NOTE The scheduled start date must be greater than or equal to the earliest start date.", + "StatusTime": "The date or time at which the status of the tasks within the schedule is analyzed.", + "TotalFloat": "The difference between the duration available to carry out a task and the scheduled duration of the task. It is a calculated elapsed time value. > NOTE Total Float time may be calculated as being the difference between the scheduled duration of a task and the available duration from earliest start to latest finish. Float time may be either positive, zero or negative. Where it is zero or negative, the task becomes critical." + }, + "description": "IfcTaskTime captures the time-related information about a task including the different types (actual or scheduled) of starting and ending times.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifctasktime.htm" + }, + "IfcTaskTimeRecurring": { + "attributes": { + "Recurrence": "" + }, + "description": "IfcTaskTimeRecurring is a recurring instance of IfcTaskTime for handling regularly scheduled or repetitive tasks.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifctasktimerecurring.htm" + }, + "IfcTaskType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a task type from which the type required may be set.", + "WorkMethod": "The method of work used in carrying out a task." + }, + "description": "An IfcTaskType defines a particular type of task that may be specified for use within a work control.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifctasktype.htm" + }, + "IfcTelecomAddress": { + "attributes": { + "ElectronicMailAddresses": "The list of Email addresses at which Email messages may be received.", + "FacsimileNumbers": "The list of fax numbers at which fax messages may be received.", + "MessagingIDs": "IDs or addresses for any other means of telecommunication, for example instant messaging, voice-over-IP, or file transfer protocols. The communication protocol is indicated by the URI value with scheme designations such as irc:, sip:, or ftp:.", + "PagerNumber": "The pager number at which paging messages may be received.", + "TelephoneNumbers": "The list of telephone numbers at which telephone messages may be received.", + "WWWHomePageURL": "The world wide web address at which the preliminary page of information for the person or organization can be located. > NOTE Information on the world wide web for a person or organization may be separated into a number of pages and across a number of host sites, all of which may be linked together. It is assumed that all such information may be referenced from a single page that is termed the home page for that person or organization." + }, + "description": "This entity represents an address to which telephone, electronic mail and other forms of telecommunications should be addressed.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcactorresource/lexical/ifctelecomaddress.htm" + }, + "IfcTendon": { + "attributes": { + "AnchorageSlip": "The deformation of an anchor or slippage of tendons when the prestressing device is released.", + "CrossSectionArea": "The effective cross-section area of the tendon.", + "FrictionCoefficient": "The friction coefficient between tendon and tendon sheet while the tendon is unbonded.", + "MinCurvatureRadius": "The smallest curvature radius calculated on the whole effective length of the tendon where the tension properties are still valid.", + "NominalDiameter": "The nominal diameter defining the cross-section size of the tendon.", + "PreStress": "The prestress to be applied on the tendon.", + "PredefinedType": "Predefined generic types for a tendon.", + "TensionForce": "The maximum allowed tension force that can be applied on the tendon." + }, + "description": "A tendon is a steel element such as a wire, cable, bar, rod, or strand used to impart prestress to concrete when the element is tensioned.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifctendon.htm" + }, + "IfcTendonAnchor": { + "attributes": { + "PredefinedType": "Kind of tendon anchor." + }, + "description": "A tendon anchor is the end connection for tendons in prestressed or posttensioned concrete.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifctendonanchor.htm" + }, + "IfcTendonAnchorType": { + "attributes": { + "PredefinedType": "Subtype of tendon anchor." + }, + "description": "The reinforcing element type IfcTendonAnchorType defines commonly shared information for occurrences of tendon anchors. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifctendonanchortype.htm" + }, + "IfcTendonType": { + "attributes": { + "CrossSectionArea": "The effective cross-section area of the prestressed part of the tendon.", + "NominalDiameter": "The nominal diameter defining the cross-section size of the prestressed part of the tendon.", + "PredefinedType": "Subtype of tendon.", + "SheathDiameter": "Diameter of the sheeth (duct) around the tendon, if there is one with this type of tendon." + }, + "description": "The reinforcing element type IfcTendonType defines commonly shared information for occurrences of tendons. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifctendontype.htm" + }, + "IfcTessellatedFaceSet": { + "attributes": { + "Coordinates": "An ordered list of Cartesian points used by the coordinate index defined at the subtypes of _IfcTessellatedFaceSet_.", + "Dim": "The space dimensionality of this geometric representation item, it is always 3. 3", + "HasColours": "Reference to the indexed colour map providing the corresponding colour RGB values to the faces of the subtypes of _IfcTessellatedFaceSet_.", + "HasTextures": "Reference to the indexed texture map providing the corresponding texture coordinates to the vertices bounding the faces of the subtypes of _IfcTessellatedFaceSet_." + }, + "description": "The IfcTessellatedFaceSet is a boundary representation topological model limited to planar faces and straight edges. It may represent an approximation of an analytical surface or solid that may be provided in addition to its tessellation as a separate shape representation. The IfcTessellatedFaceSet provides a compact data representation of an connected face set using indices into ordered lists of vertices, normals, colours, and texture maps.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifctessellatedfaceset.htm" + }, + "IfcTessellatedItem": { + "description": "The IfcTessellatedItem is the abstract supertype of all tessellated geometric models.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifctessellateditem.htm" + }, + "IfcTextLiteral": { + "attributes": { + "Literal": "The text literal to be presented.", + "Path": "The writing direction of the text literal.", + "Placement": "An _IfcAxis2Placement_ that determines the placement and orientation of the presented string." + }, + "description": "The text literal is a geometric representation item which describes a text string using a string literal and additional position and path information. The text size and appearance is determined by the IfcTextStyle that is associated to the IfcTextLiteral through an IfcStyledItem.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifctextliteral.htm" + }, + "IfcTextLiteralWithExtent": { + "attributes": { + "BoxAlignment": "The alignment of the text literal relative to its position.", + "Extent": "The extent in the x and y direction of the text literal." + }, + "description": "The text literal with extent is a text literal with the additional explicit information of the planar extent. An alignment attribute defines how the text box is aligned to the placement and how it may expand if additional lines of text need to be added.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationdefinitionresource/lexical/ifctextliteralwithextent.htm" + }, + "IfcTextStyle": { + "attributes": { + "ModelOrDraughting": "Indication whether the length measures provided for the presentation style are model based, or draughting based.", + "TextCharacterAppearance": "A character style to be used for presented text.", + "TextFontStyle": "The style applied to the text font for its visual appearance. It defines the font family, font style, weight and size.", + "TextStyle": "The style applied to the text block for its visual appearance." + }, + "description": "The IfcTextStyle is a presentation style for annotations that place a text in model space. The IfcTextStyle provides the text style for presentation information assigned to IfcTextLiteral's. The style is defined by color, text font characteristics, and text box characteristics.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctextstyle.htm" + }, + "IfcTextStyleFontModel": { + "attributes": { + "FontFamily": "The value is a prioritized list of font family names and/or generic family names. The first list entry has the highest priority, if this font fails, the next list item shall be used. The last list item should (if possible) be a generic family.", + "FontSize": "The font size provides the size or height of the text font. > NOTE The following values are allowed,", + "FontStyle": "The font style property selects between normal (sometimes referred to as \"roman\" or \"upright\"), italic and oblique faces within a font family.", + "FontVariant": "The font variant property selects between normal and small-caps. > NOTE It has been introduced for later compliance to full CSS1 support.", + "FontWeight": "The font weight property selects the weight of the font. > NOTE Values other then 'normal' and 'bold' have been introduced for later compliance to full CSS1 support." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctextstylefontmodel.htm" + }, + "IfcTextStyleForDefinedFont": { + "attributes": { + "BackgroundColour": "This property sets the background color of an element.", + "Colour": "This property describes the text color of an element (often referred to as the foreground color)." + }, + "description": "The IfcTextStyleForDefinedFont combines the text font color with an optional background color, that fills the text box, defined by the planar extent given to the text literal.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctextstylefordefinedfont.htm" + }, + "IfcTextStyleTextModel": { + "attributes": { + "LetterSpacing": "The length unit indicates an addition to the default space between characters. Values can be negative, but there may be implementation-specific limits. The importing application is free to select the exact spacing algorithm. The letter spacing may also be influenced by justification (which is a value of the _TextAlign_ attribute). > NOTE The following values are allowed, _IfcDescriptiveMeasure_ with value='normal', _IfcRatioMeasure_, or _IfcLengthMeasure_, where the length unit is globally defined at _IfcUnitAssignment_.", + "LineHeight": "The property sets the distance between two adjacent lines' baselines. When a ratio value is specified, the line height is given by the font size of the current element multiplied with the numerical value. A value of 'normal' sets the line height to a reasonable value for the element's font. It is suggested that importing applications set the 'normal' value to be a ratio number in the range of 1.0 to 1.2. > NOTE The following values are allowed: _IfcDescriptiveMeasure_ with value='normal', or _IfcLengthMeasure_, with non-negative values, the length unit is globally defined at _IfcUnitAssignment_, or _IfcRatioMeasure_.__", + "TextAlign": "This property describes how text is aligned horizontally within the element. The actual justification algorithm used is dependent on the rendering algorithm.", + "TextDecoration": "This property describes decorations that are added to the text of an element.", + "TextIndent": "The property specifies the indentation that appears before the first formatted line. > NOTE It has been introduced for later compliance to full CSS support.", + "TextTransform": "This property describes how text characters may transform to upper case, lower case, or capitalized case, independent of the character case used in the text literal. > NOTE It has been introduced for later compliance to full CSS support.", + "WordSpacing": "The length unit indicates an addition to the default space between words. Values can be negative, but there may be implementation-specific limits. The importing application is free to select the exact spacing algorithm. The word spacing may also be influenced by justification (which is a value of the 'text-align' property). > NOTE It has been introduced for later compliance to full CSS support." + }, + "description": "The IfcTextStyleTextModel combines all text style properties, that affect the presentation of a text literal within a given extent. It includes the spacing between characters and words, the horizontal and vertical alignment of the text within the planar box of the extent, decorations (like underline), transformations of the literal (like uppercase), and the height of each text line within a multi-line text block.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctextstyletextmodel.htm" + }, + "IfcTextureCoordinate": { + "attributes": { + "Maps": "Reference to the one (or many in case of multi textures with identity transformation to geometric surfaces) subtype(s) of _IfcSurfaceTexture_ that are mapped to a geometric surface by the texture coordinate transformation." + }, + "description": "The IfcTextureCoordinate is an abstract supertype of the different kinds to apply texture coordinates to geometries. For vertex based geometries an explicit assignment of 2D texture vertices to the 3D geometry points is supported by the subtype IfcTextureMap, in addition there can be a procedural description of how texture coordinates shall be applied to geometric items. If no IfcTextureCoordinate is provided for the IfcSurfaceTexture, the default mapping shall be used.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctexturecoordinate.htm" + }, + "IfcTextureCoordinateGenerator": { + "attributes": { + "Mode": "The _Mode_ attribute describes the algorithm used to compute texture coordinates. > NOTE The applicable values for the _Mode_ attribute are determined by view definitions or implementer agreements. It is recommended to use the modes described in ISO/IES 19775-1.2:2008 X3D Architecture and base components Edition 2, Part 1. See [18.4.8 TextureCoordinateGenerator](http://www.web3d.org/x3d/specifications/ISO-IEC-19775-1.2-X3D-AbstractSpecification/Part01/components/texturing.html#TextureCoordinateGenerator) for recommended values.", + "Parameter": "The parameters used as arguments by the function as specified by _Mode_." + }, + "description": "The IfcTextureCoordinateGenerator describes a procedurally defined mapping function with input parameter to map 2D texture coordinates to 3D geometry vertices. The allowable Mode values and input Parameter need to be agreed upon in view definitions and implementer agreements.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctexturecoordinategenerator.htm" + }, + "IfcTextureMap": { + "attributes": { + "MappedTo": "The face that defines the corresponding list of points along the bounding poly loop of the face outer bound. > NOTE The face may have additional inner loops. The _IfcTextureMap_ and its _Vertices_ only correspond with the coordinates of the _IfcPolyloop_ representing the outer bound.", + "Vertices": "List of texture coordinate vertices that are applied to the corresponding points of the polyloop defining a face bound." + }, + "description": "An IfcTextureMap provides the mapping of the 2-dimensional texture coordinates to the surface onto which it is mapped. It is used for mapping the texture to surfaces of vertex based geometry models, such as", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctexturemap.htm" + }, + "IfcTextureVertex": { + "attributes": { + "Coordinates": "The first Coordinate[1] is the S, the second Coordinate[2] is the T parameter value." + }, + "description": "An IfcTextureVertex is a list of 2 (S, T) texture coordinates.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctexturevertex.htm" + }, + "IfcTextureVertexList": { + "attributes": { + "TexCoordsList": "List of texture vertices defined by S-coordinate and T-coordinate." + }, + "description": "The IfcTextureVertexList defines an ordered collection of texture vertices. Each texture vertex is a two-dimensional vertex provided by a fixed list of two texture coordinates. The attribute TexCoordsList is a two-dimensional list, where", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcpresentationappearanceresource/lexical/ifctexturevertexlist.htm" + }, + "IfcTimePeriod": { + "attributes": { + "EndTime": "End time of the time period.", + "StartTime": "Start time of the time period." + }, + "description": "IfcTimePeriod defines a time period given by a start and end time. Both time definitions consider the time zone and allow for the daylight savings offset.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifctimeperiod.htm" + }, + "IfcTimeSeries": { + "attributes": { + "DataOrigin": "The origin of a time series data.", + "Description": "A text description of the data that the series represents.", + "EndTime": "The end time of a time series.", + "HasExternalReference": "Reference to an external reference, e.g. library, classification, or document information, that is associated to the IfcTimeSeries.", + "Name": "An unique name for the time series.", + "StartTime": "The start time of a time series.", + "TimeSeriesDataType": "The time series data type.", + "Unit": "The unit to be assigned to all values within the time series. Note that mixing units is not allowed. If the value is not given, the global unit for the type of _IfcValue_, as defined at _IfcProject.UnitsInContext_ is used.", + "UserDefinedDataOrigin": "Value of the data origin if DataOrigin attribute is USERDEFINED." + }, + "description": "A time series is a set of a time-stamped data entries. It allows a natural association of data collected over intervals of time. Time series can be regular or irregular. In regular time series data arrive predictably at predefined intervals. In irregular time series some or all time stamps do not follow a repetitive pattern and unpredictable bursts of data may arrive at unspecified points in time.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifctimeseries.htm" + }, + "IfcTimeSeriesValue": { + "attributes": { + "ListValues": "A list of time-series values. At least one value is required." + }, + "description": "A time series value is a list of values that comprise the time series. At least one value must be supplied. Applications are expected to normalize values by applying the following three rules:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifctimeseriesvalue.htm" + }, + "IfcTopologicalRepresentationItem": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifctopologicalrepresentationitem.htm" + }, + "IfcTopologyRepresentation": { + "description": "IfcTopologyRepresentation represents the concept of a particular topological representation of a product or a product component within a representation context. This representation context does not need to be (but may be) a geometric representation context. Several representation types for shape representation are included as predefined types:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcrepresentationresource/lexical/ifctopologyrepresentation.htm" + }, + "IfcToroidalSurface": { + "attributes": { + "MajorRadius": "The major radius of the torus.", + "MinorRadius": "The minor radius of the torus." + }, + "description": "The IfcToroidalSurface is a bounded elementary surface. It is constructed by completely revolving a circle around an axis line. The inherited Position attribute defines the IfcAxisPlacement3D and provides:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifctoroidalsurface.htm" + }, + "IfcTransformer": { + "attributes": { + "PredefinedType": "" + }, + "description": "A transformer is an inductive stationary device that transfers electrical energy from one circuit to another.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifctransformer.htm" + }, + "IfcTransformerType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of transformer from which the type required may be set." + }, + "description": "The energy conversion device type IfcTransformerType defines commonly shared information for occurrences of transformers. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/lexical/ifctransformertype.htm" + }, + "IfcTransportElement": { + "attributes": { + "PredefinedType": "Predefined generic types for a transportation element that are specified in an enumeration. There might be property sets defined specifically for each predefined type." + }, + "description": "A transport element is a generalization of all transport related objects that move people, animals or goods within a building or building complex. The IfcTransportElement defines the occurrence of a transport element, that (if given), is expressed by the IfcTransportElementType.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifctransportelement.htm" + }, + "IfcTransportElementType": { + "attributes": { + "PredefinedType": "Predefined types to define the particular type of the transport element. There may be property set definitions available for each predefined type." + }, + "description": "The element type IfcTransportElementType defines commonly shared information for occurrences of transport elements. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifctransportelementtype.htm" + }, + "IfcTrapeziumProfileDef": { + "attributes": { + "BottomXDim": "The extent of the bottom line measured along the implicit x-axis.", + "TopXDim": "The extent of the top line measured along the implicit x-axis.", + "TopXOffset": "Offset from the beginning of the top line to the bottom line, measured along the implicit x-axis.", + "YDim": "The extent of the distance between the parallel bottom and top lines measured along the implicit y-axis." + }, + "description": "IfcTrapeziumProfileDef defines a trapezium as the profile definition used by the swept surface geometry or the swept area solid. It is given by its Top X and Bottom X extent and its Y extent as well as by the offset of the Top X extend, and placed within the 2D position coordinate system, established by the Position attribute. It is placed centric within the position coordinate system, that is, in the center of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifctrapeziumprofiledef.htm" + }, + "IfcTriangulatedFaceSet": { + "attributes": { + "Closed": "Indication whether the _IfcTriangulatedFaceSet_ is a closed shell or not. If omited no such information can be provided.", + "CoordIndex": "Two-dimensional list for the indexed-based triangles, where * The first dimension represents the triangles (from 1 to N) * The second dimension has exactly three values representing the indices to three vertex points (from 1 to 3). > NOTE The coordinates of the vertices are provided by the indexed list of _SELF\\IfcTessellatedFaceSet.Coordinates.CoordList_.", + "Normals": "An ordered list of three directions for normals. It is a two-dimensional list of directions provided by three parameter values. * The first dimension corresponds to the vertex indices of the _Coordindex_ * The second dimension has exactly three values, [1] the x-direction, [2] the y-direction and [3] the z-directions", + "NumberOfTriangles": "Derived number of triangles used for this triangulation. SIZEOF(CoordIndex)", + "PnIndex": "The list of integers defining the locations in the _IfcCartesianPointList3D_ to obtain the point coordinates for the indices withint the _CoordIndex_. If the _PnIndex_ is not provided the indices point directly into the _IfcCartesianPointList3D_." + }, + "description": "The IfcTriangulatedFaceSet is a tessellated face set with all faces being bound by triangles. The faces are constructed by implicit polylines defined by three Cartesian points. Depending on the value of the attribute Closed the instance of IfcTriangulatedFaceSet represents:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricmodelresource/lexical/ifctriangulatedfaceset.htm" + }, + "IfcTrimmedCurve": { + "attributes": { + "BasisCurve": "The curve to be trimmed. For curves with multiple representations any parameter values given as Trim1 or Trim2 refer to the master representation of the BasisCurve only.", + "MasterRepresentation": "Where both parameter and point are present at either end of the curve this indicates the preferred form.", + "SenseAgreement": "Flag to indicate whether the direction of the trimmed curve agrees with or is opposed to the direction of the basis curve.", + "Trim1": "The first trimming point which may be specified as a Cartesian point, as a real parameter or both.", + "Trim2": "The second trimming point which may be specified as a Cartesian point, as a real parameter or both." + }, + "description": "An IfcTrimmedCurve is a bounded curve that is trimmed at both ends. The trimming points may be provided by a Cartesian point or by a parameter value, based on the parameterization of the BasisCurve. The SenseAgreement attribute indicates whether the direction of the IfcTrimmedCurve agrees with or is opposed to the direction of the BasisCurve.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifctrimmedcurve.htm" + }, + "IfcTubeBundle": { + "attributes": { + "PredefinedType": "" + }, + "description": "A tube bundle is a device consisting of tubes and bundles of tubes used for heat transfer and contained typically within other energy conversion devices, such as a chiller or coil.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifctubebundle.htm" + }, + "IfcTubeBundleType": { + "attributes": { + "PredefinedType": "Defines the type of tube bundle." + }, + "description": "The energy conversion device type IfcTubeBundleType defines commonly shared information for occurrences of tube bundles. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifctubebundletype.htm" + }, + "IfcTypeObject": { + "attributes": { + "ApplicableOccurrence": "The attribute optionally defines the data type of the occurrence object, to which the assigned type object can relate. If not present, no instruction is given to which occurrence object the type object is applicable. The following conventions are used: * The IFC entity name of the applicable occurrence using the IFC naming convention, CamelCase with IFC prefix * It can be optionally followed by the predefined type after the separator \"/\" (forward slash), using uppercase * If one type object is applicable to many occurrence objects, then those occurrence object names should be separate by comma \",\" forming a comma separated string. > EXAMPLE Refering to a furniture as applicable occurrence entity would be expressed as 'IfcFurnishingElement', refering to a brace as applicable entity would be expressed as 'IfcMember/BRACE', refering to a wall and wall standard case would be expressed as 'IfcWall, IfcWallStandardCase'.", + "HasPropertySets": "Set ~~list~~ of unique property sets, that are associated with the object type and are common to all object occurrences referring to this object type.", + "Types": "Reference to the relationship IfcRelDefinedByType and thus to those occurrence objects, which are defined by this type." + }, + "description": "The object type defines the specific information about a type, being common to all occurrences of this type. It refers to the specific level of the well recognized generic - specific - occurrance modeling paradigm. The IfcTypeObject gets assigned to the individual object instances (the occurrences) via the IfcRelDefinesByType relationship.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifctypeobject.htm" + }, + "IfcTypeProcess": { + "attributes": { + "Identification": "An identifying designation given to a process type.", + "LongDescription": "An long description, or text, describing the activity in detail. > NOTE The inherited _SELF\\IfcRoot.Description_ attribute is used as the short description.", + "OperatesOn": "Set of relationships to other objects, e.g. products, processes, controls, resources or actors that are operated on by the process type. > HISTORY New inverse relationship in IFC4.", + "ProcessType": "The type denotes a particular type that indicates the process further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED." + }, + "description": "IfcTypeProcess defines a specific (or type) definition of a process or activity without being assigned to a schedule or a time. It is used to define a process or activity specification, that is, the specific process or activity information that is common to all occurrences that are defined for that process or activity type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifctypeprocess.htm" + }, + "IfcTypeProduct": { + "attributes": { + "ReferencedBy": "Reference to the _IfcRelAssignsToProduct_ relationship, by which other products, processes, controls, resources or actors (as subtypes of _IfcObjectDefinition_) can be related to this product type.", + "RepresentationMaps": "List of unique representation maps. Each representation map describes a block definition of the shape of the product style. By providing more than one representation map, a multi-view block definition can be given.", + "Tag": "The tag (or label) identifier at the particular type of a product, e.g. the article number (like the EAN). It is the identifier at the specific level." + }, + "description": "IfcTypeProduct defines a type definition of a product without being already inserted into a project structure (without having a placement), and not being included in the geometric representation context of the project. It is used to define a product specification, that is, the specific product information that is common to all occurrences of that product type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifctypeproduct.htm" + }, + "IfcTypeResource": { + "attributes": { + "Identification": "An identifying designation given to a resource type.", + "LongDescription": "An long description, or text, describing the resource in detail. > NOTE The inherited _SELF\\IfcRoot.Description_ attribute is used as the short description.", + "ResourceOf": "Set of relationships to other objects, e.g. products, processes, controls, resources or actors to which this resource type is a resource. > HISTORY New inverse relationship in IFC4.", + "ResourceType": "The type denotes a particular type that indicates the resource further. The use has to be established at the level of instantiable subtypes. In particular it holds the user defined type, if the enumeration of the attribute 'PredefinedType' is set to USERDEFINED." + }, + "description": "IfcTypeResource defines a specific (or type) definition of a resource. It is used to define a resource specification (the specific resource, that is common to all occurrences that are defined for that resource) and could act as a resource template.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/lexical/ifctyperesource.htm" + }, + "IfcUShapeProfileDef": { + "attributes": { + "Depth": "Web lengths, see illustration above (= h).", + "EdgeRadius": "Edge radius according the above illustration (= r2).", + "FilletRadius": "Fillet radius according the above illustration (= r1).", + "FlangeSlope": "Slope of flange of the profile.", + "FlangeThickness": "Constant wall thickness of flange (= tg).", + "FlangeWidth": "Flange lengths, see illustration above (= b).", + "WebThickness": "Constant wall thickness of web (= ts)." + }, + "description": "IfcUShapeProfileDef defines a section profile that provides the defining parameters of a U-shape (channel) section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profile's centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifcushapeprofiledef.htm" + }, + "IfcUnitAssignment": { + "attributes": { + "Units": "Units to be included within a unit assignment." + }, + "description": "IfcUnitAssignment indicates a set of units which may be assigned. Within an IfcUnitAssigment each unit definition shall be unique; that is, there shall be no redundant unit definitions for the same unit type such as length unit or area unit. For currencies, there shall be only a single IfcMonetaryUnit within an IfcUnitAssignment.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmeasureresource/lexical/ifcunitassignment.htm" + }, + "IfcUnitaryControlElement": { + "attributes": { + "PredefinedType": "" + }, + "description": "A unitary control element combines a number of control components into a single product, such as a thermostat or humidistat.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcunitarycontrolelement.htm" + }, + "IfcUnitaryControlElementType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of unitary control element from which the type required may be set." + }, + "description": "The distribution control element type IfcUnitaryControlElementType defines commonly shared information for occurrences of unitary control elements. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/lexical/ifcunitarycontrolelementtype.htm" + }, + "IfcUnitaryEquipment": { + "attributes": { + "PredefinedType": "" + }, + "description": "Unitary equipment typically combine a number of components into a single product, such as air handlers, pre-packaged rooftop air-conditioning units, heat pumps, and split systems.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcunitaryequipment.htm" + }, + "IfcUnitaryEquipmentType": { + "attributes": { + "PredefinedType": "The type of unitary equipment." + }, + "description": "The energy conversion device type IfcUnitaryEquipmentType defines commonly shared information for occurrences of unitary equipments. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcunitaryequipmenttype.htm" + }, + "IfcValve": { + "attributes": { + "PredefinedType": "" + }, + "description": "A valve is used in a building services piping distribution system to control or modulate the flow of the fluid.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcvalve.htm" + }, + "IfcValveType": { + "attributes": { + "PredefinedType": "The type of valve." + }, + "description": "The flow controller type IfcValveType defines commonly shared information for occurrences of valves. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcvalvetype.htm" + }, + "IfcVector": { + "attributes": { + "Dim": "The space dimensionality of this class, it is derived from Orientation Orientation.Dim", + "Magnitude": "The magnitude of the vector. All vectors of Magnitude 0.0 are regarded as equal in value regardless of the orientation attribute.", + "Orientation": "The direction of the vector." + }, + "description": "An IfcVector is a geometric representation item having both a magnitude and direction. The magnitude of the vector is solely defined by the Magnitude attribute and the direction is solely defined by the Orientation attribute.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometryresource/lexical/ifcvector.htm" + }, + "IfcVertex": { + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcvertex.htm" + }, + "IfcVertexLoop": { + "attributes": { + "LoopVertex": "The vertex which defines the entire loop." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcvertexloop.htm" + }, + "IfcVertexPoint": { + "attributes": { + "VertexGeometry": "The geometric point, which defines the position in geometric space of the vertex." + }, + "description": "", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifctopologyresource/lexical/ifcvertexpoint.htm" + }, + "IfcVibrationIsolator": { + "attributes": { + "PredefinedType": "" + }, + "description": "A vibration isolator is a device used to minimize the effects of vibration transmissibility in a building.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcvibrationisolator.htm" + }, + "IfcVibrationIsolatorType": { + "attributes": { + "PredefinedType": "Defines the type of vibration isolator." + }, + "description": "The element component type IfcVibrationIsolatorType defines commonly shared information for occurrences of vibration isolators. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/lexical/ifcvibrationisolatortype.htm" + }, + "IfcVirtualElement": { + "description": "A virtual element is a special element used to provide imaginary boundaries, such as between two adjacent, but not separated, spaces. Virtual elements are usually not displayed and does not have quantities and other measures. Therefore IfcVirtualElement does not have material information and quantities attached.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifcvirtualelement.htm" + }, + "IfcVirtualGridIntersection": { + "attributes": { + "IntersectingAxes": "Two grid axes which intersects at exactly one intersection (see also informal proposition at IfcGrid). If attribute OffsetDistances is omitted, the intersection defines the placement or ref direction of a grid placement directly. If OffsetDistances are given, the intersection is defined by the offset curves to the grid axes.", + "OffsetDistances": "Offset distances to the grid axes. If given, it defines virtual offset curves to the grid axes. The intersection of the offset curves specify the virtual grid intersection." + }, + "description": "IfcVirtualGridIntersection defines the derived location of the intersection between two grid axes. Offset values may be given to set an offset distance to the grid axis for the calculation of the virtual grid intersection.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcgeometricconstraintresource/lexical/ifcvirtualgridintersection.htm" + }, + "IfcVoidingFeature": { + "attributes": { + "PredefinedType": "Qualifies the feature regarding its shape and configuration relative to the voided element." + }, + "description": "A voiding feature is a modification of an element which reduces its volume. Such a feature may be manufactured in different ways, for example by cutting, drilling, or milling of members made of various materials, or by inlays into the formwork of cast members made of materials such as concrete.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/lexical/ifcvoidingfeature.htm" + }, + "IfcWall": { + "attributes": { + "PredefinedType": "Predefined generic type for a wall that is specified in an enumeration. There may be a property set given specifically for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcWallType_ is assigned, providing its own _IfcWallType.PredefinedType_." + }, + "description": "The wall represents a vertical construction that bounds or subdivides spaces. Wall are usually vertical, or nearly vertical, planar elements, often designed to bear structural loads. A wall is however not required to be load bearing.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwall.htm" + }, + "IfcWallElementedCase": { + "description": "The IfcWallElementedCase defines a wall with certain constraints for the provision of its components. The IfcWallElementedCase handles all cases of walls, that are decomposed into parts:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwallelementedcase.htm" + }, + "IfcWallStandardCase": { + "description": "The IfcWallStandardCase defines a wall with certain constraints for the provision of parameters and with certain constraints for the geometric representation. The IfcWallStandardCase handles all cases of walls, that are extruded vertically:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwallstandardcase.htm" + }, + "IfcWallType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a wall element from which the type required may be set." + }, + "description": "The element type IfcWallType defines commonly shared information for occurrences of walls. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwalltype.htm" + }, + "IfcWasteTerminal": { + "attributes": { + "PredefinedType": "" + }, + "description": "A waste terminal has the purpose of collecting or intercepting waste from one or more sanitary terminals or other fluid waste generating equipment and discharging it into a single waste/drainage system.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcwasteterminal.htm" + }, + "IfcWasteTerminalType": { + "attributes": { + "PredefinedType": "Identifies the predefined types of waste terminal from which the type required may be set." + }, + "description": "The flow terminal type IfcWasteTerminalType defines commonly shared information for occurrences of waste terminals. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/lexical/ifcwasteterminaltype.htm" + }, + "IfcWindow": { + "attributes": { + "OverallHeight": "Overall measure of the height, it reflects the Z Dimension of a bounding box, enclosing the window opening. If omitted, the _OverallHeight_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE The body of the window might be taller then the window opening (for example in cases where the window lining includes a casing). In these cases the _OverallHeight_ shall still be given as the window opening height, and not as the total height of the window lining.", + "OverallWidth": "Overall measure of the width, it reflects the X Dimension of a bounding box, enclosing the window opening. If omitted, the _OverallWidth_ should be taken from the geometric representation of the _IfcOpening_ in which the window is inserted. > NOTE The body of the window might be wider then the window opening (for example in cases where the window lining includes a casing). In these cases the _OverallWidth_ shall still be given as the window opening width, and not as the total width of the window lining.", + "PartitioningType": "Type defining the general layout of the window in terms of the partitioning of panels. > NOTE The _PartitioningType_ shall only be used, if no type object _IfcWindowType_ is assigned, providing its own _IfcWindowType.PartitioningType_.", + "PredefinedType": "Predefined generic type for a window that is specified in an enumeration. There may be a property set given specificly for the predefined types. > NOTE The _PredefinedType_ shall only be used, if no _IfcWindowType_ is assigned, providing its own _IfcWindowType.PredefinedType_.", + "UserDefinedPartitioningType": "Designator for the user defined partitioning type, shall only be provided, if the value of _PartitioningType_ is set to USERDEFINED." + }, + "description": "The window is a building element that is predominately used to provide natural light and fresh air. It includes vertical opening but also horizontal opening such as skylights or light domes. It includes constructions with swinging, pivoting, sliding, or revolving panels and fixed panels. A window consists of a lining and one or several panels.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwindow.htm" + }, + "IfcWindowLiningProperties": { + "attributes": { + "FirstMullionOffset": "Offset of the mullion centerline, measured along the x-axis of the window placement co-ordinate system. An offset value = 0.5 indicates that the mullion is positioned in the middle of the window.", + "FirstTransomOffset": "Offset of the transom centerline, measured along the z-axis of the window placement co-ordinate system. An offset value = 0.5 indicates that the transom is positioned in the middle of the window.", + "LiningDepth": "Depth of the window lining (dimension measured perpendicular to window elevation plane).", + "LiningOffset": "Offset of the window lining. The offset is given as distance along the y axis of the local placement (perpendicular to the window plane).", + "LiningThickness": "Thickness of the window lining as explained in the figure above. If _LiningThickness_ value is 0. (zero) it denotes a window without a lining (all other lining parameters shall be set to NIL in this case). If the _LiningThickness_ is NIL it denotes that the value is not available.", + "LiningToPanelOffsetX": "Offset between the lining and the window panel measured along the x-axis of the local placement. Should be smaller or equal to the _LiningThickness_.", + "LiningToPanelOffsetY": "Offset between the lining and the window panel measured along the y-axis of the local placement. Should be smaller or equal to the _IfcWindowPanelProperties.PanelThickness_.", + "MullionThickness": "Thickness of the mullion (vertical separator of window panels within a window), measured parallel to the window elevation plane. The mullion is part of the lining and the mullion depth is assumed to be identical to the lining depth. If the _MullionThickness_ is set to zero (and the _MullionOffset_ set to a positive length), then the window is divided horizontally without a physical divider.", + "SecondMullionOffset": "Offset of the mullion centerline for the second mullion, measured along the x-axis of the window placement co-ordinate system. An offset value = 0.666 indicates that the second mullion is positioned at two/third of the window.", + "SecondTransomOffset": "Offset of the transom centerline for the second transom, measured along the x-axis of the window placement co-ordinate system. An offset value = 0.666 indicates that the second transom is positioned at two/third of the window.", + "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the lining.", + "TransomThickness": "Thickness of the transom (horizontal separator of window panels within a window), measured parallel to the window elevation plane. The transom is part of the lining and the transom depth is assumed to be identical to the lining depth. If the _TransomThickness_ is set to zero (and the _TransomOffset_ set to a positive length), then the window is divided vertically without a physical divider." + }, + "description": "The window lining is the outer frame which enables the window to be fixed in position. The window lining is used to hold the window panels or other casements. The parameter of the IfcWindowLiningProperties define the geometrically relevant parameter of the lining.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcwindowliningproperties.htm" + }, + "IfcWindowPanelProperties": { + "attributes": { + "FrameDepth": "Depth of panel frame, measured from front face to back face horizontally (i.e. perpendicular to the window (elevation) plane.", + "FrameThickness": "Width of panel frame, measured from inside of panel (at glazing) to outside of panel (at lining), i.e. parallel to the window (elevation) plane.", + "OperationType": "Types of window panel operations. Also used to assign standard symbolic presentations according to national building standards.", + "PanelPosition": "Position of this panel within the overall window style.", + "ShapeAspectStyle": "Optional link to a shape aspect definition, which points to the part of the geometric representation of the window style, which is used to represent the panel." + }, + "description": "A window panel is a casement, that is, a component, fixed or opening, consisting essentially of a frame and the infilling. The infilling of a window panel is normally glazing. The way of operation is defined in the operation type.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcwindowpanelproperties.htm" + }, + "IfcWindowStandardCase": { + "description": "The standard window, IfcWindowStandardCase, defines a window with certain constraints for the provision of operation types, opening directions, frame and lining parameters, construction types and with certain constraints for the geometric representation. The IfcWindowStandardCase handles all cases of windows, that:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwindowstandardcase.htm" + }, + "IfcWindowStyle": { + "attributes": { + "ConstructionType": "Type defining the basic construction and material type of the window.", + "OperationType": "Type defining the general layout and operation of the window style.", + "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value.", + "Sizeable": "The Boolean indicates, whether the attached ShapeStyle can be sized (using scale factor of transformation), or not (FALSE). If not, the ShapeStyle should be inserted by the IfcWindow (using IfcMappedItem) with the scale factor = 1." + }, + "description": "The window style defines a particular style of windows, which may be included into the spatial context of the building model through instances of IfcWindow. A window style defines the overall parameter of the window style and refers to the particular parameter of the lining and one (or several) panels through IfcWindowLiningProperties and IfcWindowPanelProperties.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcarchitecturedomain/lexical/ifcwindowstyle.htm" + }, + "IfcWindowType": { + "attributes": { + "ParameterTakesPrecedence": "The Boolean value reflects, whether the parameter given in the attached lining and panel properties exactly define the geometry (TRUE), or whether the attached style shape take precedence (FALSE). In the last case the parameter have only informative value. If not provided, no such information can be infered.", + "PartitioningType": "Type defining the general layout of the window type in terms of the partitioning of panels.", + "PredefinedType": "Identifies the predefined types of a window element from which the type required may be set.", + "UserDefinedPartitioningType": "Designator for the user defined partitioning type, shall only be provided, if the value of _PartitioningType_ is set to USERDEFINED." + }, + "description": "The element type IfcWindowType defines commonly shared information for occurrences of windows. The set of shared information may include:", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/lexical/ifcwindowtype.htm" + }, + "IfcWorkCalendar": { + "attributes": { + "ExceptionTimes": "Set of times periods that define exceptions (non-working times) for the given working times including the base calendar, if provided.", + "PredefinedType": "Identifies the predefined types of a work calendar from which the type required may be set.", + "WorkingTimes": "Set of times periods that are regarded as an initial set-up of working times. Exception times can then further restrict these working times." + }, + "description": "An IfcWorkCalendar defines working and non-working time periods for tasks and resources. It enables to define both specific time periods, such as from 7:00 till 12:00 on 25th August 2009, as well as repetitive time periods based on frequently used recurrence patterns, such as each Monday from 7:00 till 12:00 between 1st March 2009 and 31st December 2009.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcworkcalendar.htm" + }, + "IfcWorkControl": { + "attributes": { + "CreationDate": "The date that the plan is created.", + "Creators": "The authors of the work plan.", + "Duration": "The total duration of the entire work schedule.", + "FinishTime": "The finish time of the schedule.", + "Purpose": "A description of the purpose of the work schedule.", + "StartTime": "The start time of the schedule.", + "TotalFloat": "The total time float of the entire work schedule." + }, + "description": "An IfcWorkControl is an abstract supertype which captures information that is common to both IfcWorkPlan and IfcWorkSchedule.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcworkcontrol.htm" + }, + "IfcWorkPlan": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a work plan from which the type required may be set." + }, + "description": "An IfcWorkPlan represents work plans in a construction or a facilities management project.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcworkplan.htm" + }, + "IfcWorkSchedule": { + "attributes": { + "PredefinedType": "Identifies the predefined types of a work schedule from which the type required may be set." + }, + "description": "An IfcWorkSchedule represents a task schedule of a work plan, which in turn can contain a set of schedules for different purposes.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/lexical/ifcworkschedule.htm" + }, + "IfcWorkTime": { + "attributes": { + "Finish": "End date of the work time (24:00), that might be further restricted by a recurrence pattern.", + "RecurrencePattern": "Recurrence pattern that defines a time period, which, if given, is valid within the time period defined by _IfcWorkTime.Start_ and _IfcWorkTime.Finish_.", + "Start": "Start date of the work time (0:00), that might be further restricted by a recurrence pattern." + }, + "description": "IfcWorkTime defines time periods that are used by IfcWorkCalendar for either describing working times or non-working exception times. Besides start and finish dates, a set of time periods can be given by various types of recurrence patterns.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcdatetimeresource/lexical/ifcworktime.htm" + }, + "IfcZShapeProfileDef": { + "attributes": { + "Depth": "Web length, see illustration above (= h).", + "EdgeRadius": "Edge radius according the above illustration (= r2).", + "FilletRadius": "Fillet radius according the above illustration (= r1).", + "FlangeThickness": "Constant wall thickness of flange, see illustration above (= tg).", + "FlangeWidth": "Flange length, see illustration above (= b).", + "WebThickness": "Constant wall thickness of web, see illustration above (= ts)." + }, + "description": "IfcZShapeProfileDef defines a section profile that provides the defining parameters of a Z-shape section to be used by the swept area solid. Its parameters and orientation relative to the position coordinate system are according to the following illustration. The centre of the position coordinate system is in the profile's centre of the bounding box.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/lexical/ifczshapeprofiledef.htm" + }, + "IfcZone": { + "attributes": { + "LongName": "Long name for a zone, used for informal purposes. It should be used, if available, in conjunction with the inherited _Name_ attribute. > NOTE In many scenarios the _Name_ attribute refers to the short name or number of a zone, and the _LongName_ refers to the full name." + }, + "description": "A zone is a group of spaces, partial spaces or other zones. Zone structures may not be hierarchical (in contrary to the spatial structure of a project - see IfcSpatialStructureElement), i.e. one individual IfcSpace may be associated with zero, one, or several IfcZone's. IfcSpace's are grouped into an IfcZone by using the objectified relationship IfcRelAssignsToGroup as specified at the supertype IfcGroup.", + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/lexical/ifczone.htm" + } +} \ No newline at end of file diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_properties.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_properties.json new file mode 100644 index 0000000000..ab84c8e6bc --- /dev/null +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_properties.json @@ -0,0 +1,10976 @@ +{ + "Pset_ActionRequest": { + "properties": { + "RequestComments": { + "description": "Comments that may be made on the request." + }, + "RequestSourceLabel": { + "description": "A specific name or label that further qualifies the identity of a request source. In the event of an email, this may be the email address." + }, + "RequestSourceName": { + "description": "The person making the request, where known." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_actionrequest.htm" + }, + "Pset_ActorCommon": { + "properties": { + "Category": { + "description": "Designation of the category into which the actors in the population belong." + }, + "NumberOfActors": { + "description": "The number of actors that are to be dealt with together in the population." + }, + "SkillLevel": { + "description": "Skill level exhibited by the actor and which indicates an extent of their capability to perform actions on the artefacts upon which they can act." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifckernel/pset/pset_actorcommon.htm" + }, + "Pset_ActuatorPHistory": { + "properties": { + "Position": { + "description": "Indicates position of the actuator over time where 0.0 is fully closed and 1.0 is fully open." + }, + "Quality": { + "description": "Indicates the quality of measurement or failure condition, which may be further qualified by the Status. True: measured values are considered reliable; False: measured values are considered not reliable (i.e. a fault has been detected); Unknown: reliability of values is uncertain." + }, + "Status": { + "description": "Indicates an error code or identifier, whose meaning is specific to the particular automation system. Example values include: 'ConfigurationError', 'NotConnected', 'DeviceFailure', 'SensorFailure', 'LastKnown, 'CommunicationsFailure', 'OutOfService'." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatorphistory.htm" + }, + "Pset_ActuatorTypeCommon": { + "properties": { + "Application": { + "description": "Indicates application of actuator." + }, + "FailPosition": { + "description": "Specifies the required fail-safe position of the actuator." + }, + "ManualOverride": { + "description": "Identifies whether hand-operated operation is provided as an override (= TRUE) or not (= FALSE). Note that this value should be set to FALSE by default in the case of a Hand Operated Actuator." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortypecommon.htm" + }, + "Pset_ActuatorTypeElectricActuator": { + "properties": { + "ActuatorInputPower": { + "description": "Maximum input power requirement." + }, + "ElectricActuatorType": { + "description": "Enumeration that identifies electric actuator as defined by its operational principle." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortypeelectricactuator.htm" + }, + "Pset_ActuatorTypeHydraulicActuator": { + "properties": { + "InputFlowrate": { + "description": "Maximum hydraulic flowrate requirement." + }, + "InputPressure": { + "description": "Maximum design pressure for the actuator." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortypehydraulicactuator.htm" + }, + "Pset_ActuatorTypeLinearActuation": { + "properties": { + "Force": { + "description": "Indicates the maximum close-off force for the actuator." + }, + "Stroke": { + "description": "Indicates the maximum distance the actuator must traverse." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortypelinearactuation.htm" + }, + "Pset_ActuatorTypePneumaticActuator": { + "properties": { + "InputFlowrate": { + "description": "Maximum input control air flowrate requirement." + }, + "InputPressure": { + "description": "Maximum input control air pressure requirement." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortypepneumaticactuator.htm" + }, + "Pset_ActuatorTypeRotationalActuation": { + "properties": { + "RangeAngle": { + "description": "Indicates the maximum rotation the actuator must traverse." + }, + "Torque": { + "description": "Indicates the maximum close-off torque for the actuator." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_actuatortyperotationalactuation.htm" + }, + "Pset_AirSideSystemInformation": { + "properties": { + "AirSideSystemDistributionType": { + "description": "This enumeration defines the basic types of air side systems (e.g., SingleDuct, DualDuct, Multizone, etc.)." + }, + "AirSideSystemType": { + "description": "This enumeration specifies the basic types of possible air side systems (e.g., Constant Volume, Variable Volume, etc.)." + }, + "AirflowSensible": { + "description": "The air flowrate required to satisfy the sensible peak loads." + }, + "ApplianceDiversity": { + "description": "Diversity of appliance load." + }, + "CoolingTemperatureDelta": { + "description": "Cooling temperature difference for calculating space air flow rates." + }, + "Description": { + "description": "The description of the air side system." + }, + "EnergyGainSensible": { + "description": "The sum of total energy gains for the spaces served by the system during the peak cooling conditions, plus any system-level sensible energy gains." + }, + "EnergyGainTotal": { + "description": "The total amount of energy gains for the spaces served by the system during the peak cooling conditions, plus any system-level total energy gains." + }, + "EnergyLoss": { + "description": "The sum of energy losses for the spaces served by the system during the peak heating conditions." + }, + "FanPower": { + "description": "Fan motor loads contributing to the cooling load." + }, + "HeatingTemperatureDelta": { + "description": "Heating temperature difference for calculating space air flow rates." + }, + "InfiltrationDiversitySummer": { + "description": "Diversity factor for Summer infiltration." + }, + "InfiltrationDiversityWinter": { + "description": "Diversity factor for Winter infiltration." + }, + "LightingDiversity": { + "description": "Lighting diversity." + }, + "LoadSafetyFactor": { + "description": "Load safety factor." + }, + "Name": { + "description": "The name of the air side system." + }, + "TotalAirflow": { + "description": "The total design supply air flowrate required for the system for either heating or cooling conditions, whichever is greater." + }, + "Ventilation": { + "description": "Required outside air ventilation." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_airsidesysteminformation.htm" + }, + "Pset_AirTerminalBoxPHistory": { + "properties": { + "AirflowCurve": { + "description": "Air flowrate versus damper position relationship;airflow = f ( valve position)." + }, + "AtmosphericPressure": { + "description": "Ambient atmospheric pressure." + }, + "DamperPosition": { + "description": "Control damper position, ranging from 0 to 1." + }, + "Sound": { + "description": "Sound performance." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airterminalboxphistory.htm" + }, + "Pset_AirTerminalBoxTypeCommon": { + "properties": { + "AirPressureRange": { + "description": "Allowable air static pressure range at the entrance of the air terminal box." + }, + "AirflowRateRange": { + "description": "Range of airflow that can be delivered." + }, + "ArrangementType": { + "description": "Terminal box arrangement. SingleDuct: Terminal box receives warm or cold air from a single air supply duct. DualDuct: Terminal box receives warm and cold air from separate air supply ducts." + }, + "HasFan": { + "description": "Terminal box has a fan inside (fan powered box)." + }, + "HasReturnAir": { + "description": "Terminal box has return air mixed with supply air from duct work." + }, + "HasSoundAttenuator": { + "description": "Terminal box has a sound attenuator." + }, + "HousingThickness": { + "description": "Air terminal box housing material thickness." + }, + "NominalAirFlowRate": { + "description": "Nominal airflow rate." + }, + "NominalDamperDiameter": { + "description": "Nominal damper diameter." + }, + "NominalInletAirPressure": { + "description": "Nominal airflow inlet static pressure." + }, + "OperationTemperatureRange": { + "description": "Allowable operational range of the ambient air temperature." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "ReheatType": { + "description": "Terminal box reheat type." + }, + "ReturnAirFractionRange": { + "description": "Allowable return air fraction range as a fraction of discharge airflow." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airterminalboxtypecommon.htm" + }, + "Pset_AirTerminalOccurrence": { + "properties": { + "AirFlowRate": { + "description": "The actual airflow rate as designed." + }, + "AirflowType": { + "description": "Enumeration defining the functional type of air flow through the terminal." + }, + "Location": { + "description": "Location (a single type of diffuser can be used for multiple locations); high means close to ceiling." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airterminaloccurrence.htm" + }, + "Pset_AirTerminalPHistory": { + "properties": { + "AirFlowRate": { + "description": "Volumetric flow rate." + }, + "CenterlineAirVelocity": { + "description": "Centerline air velocity versus distance from the diffuser and temperature differential; a function of distance from diffuser and temperature difference between supply air and room air." + }, + "InductionRatio": { + "description": "Induction ratio versus distance from the diffuser and its discharge direction; induction ratio (or entrainment ratio) is the ratio of the volumetric flow rate in the jet to the volumetric flow rate at the air terminal." + }, + "NeckAirVelocity": { + "description": "Air velocity at the neck." + }, + "PressureDrop": { + "description": "Drop in total pressure between inlet and outlet at nominal air-flow rate." + }, + "SupplyAirTemperatureCooling": { + "description": "Supply air temperature in cooling mode." + }, + "SupplyAirTemperatureHeating": { + "description": "Supply air temperature in heating mode." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airterminalphistory.htm" + }, + "Pset_AirTerminalTypeCommon": { + "properties": { + "AirDiffusionPerformanceIndex": { + "description": "The Air Diffusion Performance Index (ADPI) is used for cooling mode conditions. If several measurements of air velocity and air temperature are made throughout the occupied zone of a space, the ADPI is the percentage of locations where measurements were taken that meet the specifications for effective draft temperature and air velocity." + }, + "AirFlowrateRange": { + "description": "Air flowrate range within which the air terminal is designed to operate." + }, + "AirFlowrateVersusFlowControlElement": { + "description": "Air flowrate versus flow control element position at nominal pressure drop." + }, + "CoreSetHorizontal": { + "description": "Degree of horizontal (in the X-axis of the LocalPlacement) blade set from the centerline." + }, + "CoreSetVertical": { + "description": "Degree of vertical (in the Y-axis of the LocalPlacement) blade set from the centerline." + }, + "CoreType": { + "description": "Identifies the way the core of the AirTerminal is constructed." + }, + "DischargeDirection": { + "description": "Discharge direction of the air terminal." + }, + "EffectiveArea": { + "description": "Effective discharge area of the air terminal." + }, + "FaceType": { + "description": "Identifies how the terminal face of an AirTerminal is constructed." + }, + "FinishColor": { + "description": "The finish color for the air terminal." + }, + "FinishType": { + "description": "The type of finish for the air terminal." + }, + "FlowControlType": { + "description": "Type of flow control element that may be included as a part of the construction of the air terminal." + }, + "FlowPattern": { + "description": "Flow pattern." + }, + "HasIntegralControl": { + "description": "If TRUE, a self powered temperature control is included in the AirTerminal." + }, + "HasSoundAttenuator": { + "description": "If TRUE, the air terminal has sound attenuation." + }, + "HasThermalInsulation": { + "description": "If TRUE, the air terminal has thermal insulation." + }, + "MountingType": { + "description": "The way the air terminal is mounted to the ceiling, wall, etc." + }, + "NeckArea": { + "description": "Neck area of the air terminal." + }, + "NumberOfSlots": { + "description": "Number of slots." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Shape": { + "description": "Shape of the air terminal. Slot is typically a long narrow supply device with an aspect ratio generally greater than 10 to 1." + }, + "SlotLength": { + "description": "Slot length." + }, + "SlotWidth": { + "description": "Slot width." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Temperature range within which the air terminal is designed to operate." + }, + "ThrowLength": { + "description": "The horizontal or vertical axial distance an airstream travels after leaving an AirTerminal before the maximum stream velocity is reduced to a specified terminal velocity under isothermal conditions at the upper value of the AirFlowrateRange." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airterminaltypecommon.htm" + }, + "Pset_AirToAirHeatRecoveryPHistory": { + "properties": { + "AirPressureDropCurves": { + "description": "Air pressure drop as function of air flow rate." + }, + "DefrostTemperatureEffectiveness": { + "description": "Temperature heat transfer effectiveness when defrosting is active." + }, + "HumidityEffectiveness": { + "description": "Humidity heat transfer effectiveness: The ratio of primary airflow absolute humidity changes to maximum possible absolute humidity changes." + }, + "LatentHeatTransferRate": { + "description": "Latent heat transfer rate." + }, + "SensibleEffectiveness": { + "description": "Sensible heat transfer effectiveness, where effectiveness is defined as the ratio of heat transfer to maximum possible heat transfer." + }, + "SensibleEffectivenessTable": { + "description": "Sensible heat transfer effectiveness curve as a function of the primary and secondary air flow rate." + }, + "SensibleHeatTransferRate": { + "description": "Sensible heat transfer rate." + }, + "TemperatureEffectiveness": { + "description": "Temperature heat transfer effectiveness: The ratio of primary airflow temperature changes to maximum possible temperature changes." + }, + "TotalEffectiveness": { + "description": "Total heat transfer effectiveness: The ratio of heat transfer to the maximum possible heat transfer." + }, + "TotalEffectivenessTable": { + "description": "Total heat transfer effectiveness curve as a function of the primary and secondary air flow rate." + }, + "TotalHeatTransferRate": { + "description": "Total heat transfer rate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airtoairheatrecoveryphistory.htm" + }, + "Pset_AirToAirHeatRecoveryTypeCommon": { + "properties": { + "HasDefrost": { + "description": "has the heat exchanger has defrost function or not." + }, + "HeatTransferType": { + "description": "Type of heat transfer between the two air streams." + }, + "OperationalTemperatureRange": { + "description": "Allowable operation ambient air temperature range." + }, + "PrimaryAirflowRateRange": { + "description": "possible range of primary airflow that can be delivered.." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "SecondaryAirflowRateRange": { + "description": "possible range of secondary airflow that can be delivered." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_airtoairheatrecoverytypecommon.htm" + }, + "Pset_AlarmPHistory": { + "properties": { + "Acknowledge": { + "description": "Indicates acknowledgement status where False indicates acknowlegement is required and outstanding, True indicates condition has been acknowedged, and Unknown indicates no acknowledgement is required. Upon resetting the condition, then acknowledgement reverts to Unknown." + }, + "Condition": { + "description": "Indicates alarm condition over time. The range of possible values and their meanings is defined by Pset_AlarmTypeCommon.Condition. An empty value indicates no present alarm condition." + }, + "Enabled": { + "description": "Indicates whether alarm is enabled or disabled over time." + }, + "Severity": { + "description": "Indicates alarm severity over time, where the scale of values is determined by the control system configuration. A zero value indicates no present alarm." + }, + "User": { + "description": "Indicates acknowledging user over time by identification corresponding to IfcPerson.Identification on an IfcActor." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_alarmphistory.htm" + }, + "Pset_AlarmTypeCommon": { + "properties": { + "Condition": { + "description": "Table mapping alarm condition identifiers to descriptive labels, which may be used for interpreting Pset_AlarmPHistory.Condition." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_alarmtypecommon.htm" + }, + "Pset_AnnotationContourLine": { + "properties": { + "ContourValue": { + "description": "Value of the elevation of the contour above or below a reference plane." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_annotationcontourline.htm" + }, + "Pset_AnnotationLineOfSight": { + "properties": { + "RoadVisibleDistanceLeft": { + "description": "Distance visible to the left of the access." + }, + "RoadVisibleDistanceRight": { + "description": "Distance visible to the right of the access." + }, + "SetbackDistance": { + "description": "Setback distance from the point of connection on the major element along the axis of the minor element (e.g. distance from a public road at which the line of sigfht is measured." + }, + "VisibleAngleLeft": { + "description": "Angle of visibility to the left of the access." + }, + "VisibleAngleRight": { + "description": "Angle of visibility to the right of the access." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_annotationlineofsight.htm" + }, + "Pset_AnnotationSurveyArea": { + "properties": { + "AccuracyQualityExpected": { + "description": "A measure of the accuracy quality of survey points as expected expressed in percentage terms." + }, + "AccuracyQualityObtained": { + "description": "A measure of the accuracy quality of survey points as obtained expressed in percentage terms." + }, + "AcquisitionMethod": { + "description": "The means by which survey data was acquired." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_annotationsurveyarea.htm" + }, + "Pset_Asset": { + "properties": { + "AssetAccountingType": { + "description": "Identifies the predefined types of risk from which the type required may be set." + }, + "AssetInsuranceType": { + "description": "Identifies the predefined types of insurance rating from which the type required may be set." + }, + "AssetTaxType": { + "description": "Identifies the predefined types of taxation group from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_asset.htm" + }, + "Pset_AudioVisualAppliancePHistory": { + "properties": { + "AudioVolume": { + "description": "Indicates the audio volume level where the integer level corresponds to an entry or interpolation within Pset_AudioVisualApplianceTypeCommon.AudioVolume." + }, + "MediaContent": { + "description": "Indicates the media content storage location, such as URLs to camera footage within particular time periods." + }, + "MediaSource": { + "description": "Indicates the media source where the identifier corresponds to an entry within the table of available media sources on Pset_AudioVisualApplianceTypeCommon.MediaSource." + }, + "PowerState": { + "description": "Indicates the power state of the device where True is on and False is off." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancephistory.htm" + }, + "Pset_AudioVisualApplianceTypeAmplifier": { + "properties": { + "AmplifierType": { + "description": "Indicates the type of amplifier." + }, + "AudioAmplification": { + "description": "Indicates audio amplification frequency ranges." + }, + "AudioMode": { + "description": "Indicates audio sound modes and corresponding labels, if applicable." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypeamplifier.htm" + }, + "Pset_AudioVisualApplianceTypeCamera": { + "properties": { + "CameraType": { + "description": "Indicates the type of camera." + }, + "IsOutdoors": { + "description": "Indicates if camera is designed to be used outdoors." + }, + "PanHorizontal": { + "description": "Indicates horizontal range for panning." + }, + "PanTiltZoomPreset": { + "description": "Indicates pan/tilt/zoom position presets." + }, + "PanVertical": { + "description": "Indicates vertical range for panning." + }, + "TiltHorizontal": { + "description": "Indicates horizontal range for pivoting, where positive values indicate the camera rotating clockwise," + }, + "TiltVertical": { + "description": "Indicates vertical range for pivoting, where 0.0 is level, +90 degrees is looking up, -90 degrees is looking down." + }, + "VideoCaptureInterval": { + "description": "Indicates video frame capture time intervals." + }, + "VideoResolutionHeight": { + "description": "Indicates the number of vertical pixels (the largest native video resolution height)." + }, + "VideoResolutionMode": { + "description": "Indicates video resolution modes." + }, + "VideoResolutionWidth": { + "description": "Indicates the number of horizontal pixels (the largest native video resolution width)." + }, + "Zoom": { + "description": "Indicates the zoom range." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypecamera.htm" + }, + "Pset_AudioVisualApplianceTypeCommon": { + "properties": { + "AudioVolume": { + "description": "Indicates discrete audio volume levels and corresponding sound power offsets, if applicable. Missing values may be interpolated." + }, + "MediaSource": { + "description": "Indicates media sources and corresponding names of ports (IfcDistributionPort with FlowDirection=SINK and PredefinedType=AUDIOVISUAL) or aggregated audio/video components (IfcAudioVisualAppliance)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypecommon.htm" + }, + "Pset_AudioVisualApplianceTypeDisplay": { + "properties": { + "AudioMode": { + "description": "Indicates audio sound modes and corresponding labels, if applicable." + }, + "Brightness": { + "description": "Indicates the display brightness." + }, + "ContrastRatio": { + "description": "Indicates the display contrast ratio." + }, + "DisplayHeight": { + "description": "Indicates the physical height of the screen (only the display surface)." + }, + "DisplayType": { + "description": "Indicates the type of display." + }, + "DisplayWidth": { + "description": "Indicates the physical width of the screen (only the display surface)." + }, + "NominalSize": { + "description": "Indicates the diagonal screen size." + }, + "RefreshRate": { + "description": "Indicates the display refresh frequency." + }, + "TouchScreen": { + "description": "Indicates touchscreen support." + }, + "VideoCaptionMode": { + "description": "Indicates video closed captioning modes." + }, + "VideoResolutionHeight": { + "description": "Indicates the number of vertical pixels, e.g. 1080." + }, + "VideoResolutionMode": { + "description": "Indicates video resolution modes." + }, + "VideoResolutionWidth": { + "description": "Indicates the number of horizontal pixels, e.g. 1920." + }, + "VideoScaleMode": { + "description": "Indicates video scaling modes." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypedisplay.htm" + }, + "Pset_AudioVisualApplianceTypePlayer": { + "properties": { + "PlayerMediaEject": { + "description": "Indicates whether the media can be ejected from the player (if physical media)." + }, + "PlayerMediaFormat": { + "description": "Indicates supported media formats." + }, + "PlayerType": { + "description": "Indicates the type of player." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypeplayer.htm" + }, + "Pset_AudioVisualApplianceTypeProjector": { + "properties": { + "ProjectorType": { + "description": "Indicates the type of projector." + }, + "VideoCaptionMode": { + "description": "Indicates closed captioning modes." + }, + "VideoResolutionHeight": { + "description": "Indicates the number of vertical pixels (the largest native video resolution height)." + }, + "VideoResolutionMode": { + "description": "Indicates video resolution modes." + }, + "VideoResolutionWidth": { + "description": "Indicates the number of horizontal pixels (the largest native video resolution width)." + }, + "VideoScaleMode": { + "description": "Indicates video scaling modes." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypeprojector.htm" + }, + "Pset_AudioVisualApplianceTypeReceiver": { + "properties": { + "AudioAmplification": { + "description": "Indicates audio amplification frequency ranges." + }, + "AudioMode": { + "description": "Indicates audio sound modes and corresponding labels, if applicable." + }, + "ReceiverType": { + "description": "Indicates the type of receiver." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypereceiver.htm" + }, + "Pset_AudioVisualApplianceTypeSpeaker": { + "properties": { + "FrequencyResponse": { + "description": "Indicates the output over a specified range of frequencies." + }, + "Impedence": { + "description": "Indicates the speaker impedence." + }, + "SpeakerDriverSize": { + "description": "Indicates the number of drivers and their sizes." + }, + "SpeakerMounting": { + "description": "Indicates how the speaker is designed to be mounted." + }, + "SpeakerType": { + "description": "Indicates the type of speaker." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypespeaker.htm" + }, + "Pset_AudioVisualApplianceTypeTuner": { + "properties": { + "TunerChannel": { + "description": "Indicates the tuner channels, if applicable." + }, + "TunerFrequency": { + "description": "Indicates the tuner frequencies, if applicable." + }, + "TunerMode": { + "description": "Indicates the tuner modes (or bands). For example, 'AnalogCable', 'DigitalAir', 'AM', 'FM'." + }, + "TunerType": { + "description": "Indicates the tuner type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_audiovisualappliancetypetuner.htm" + }, + "Pset_BeamCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for the element. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Roll": { + "description": "Rotation against the longitudinal axis - relative to the global Z direction for all beams that are non-vertical in regard to the global coordinate system (Profile direction equals global Z is Roll = 0.)" + }, + "Slope": { + "description": "Slope angle - relative to horizontal (0.0 degrees)." + }, + "Span": { + "description": "Clear span for this object." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of the element. Here the total thermal transmittance coefficient through the beam within the direction of the thermal flow (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_beamcommon.htm" + }, + "Pset_BoilerPHistory": { + "properties": { + "AuxiliaryEnergyConsumption": { + "description": "Boiler secondary energy source consumption (i.e., the electricity consumed by electrical devices such as fans and pumps)." + }, + "CombustionEfficiency": { + "description": "Combustion efficiency under nominal condition." + }, + "CombustionTemperature": { + "description": "Average combustion chamber temperature." + }, + "EnergySourceConsumption": { + "description": "Energy consumption." + }, + "Load": { + "description": "Boiler real load." + }, + "OperationalEfficiency": { + "description": "Operational efficiency: boiler output divided by total energy input (electrical and fuel)." + }, + "PartLoadRatio": { + "description": "Ratio of the real to the nominal capacity." + }, + "PrimaryEnergyConsumption": { + "description": "Boiler primary energy source consumption (i.e., the fuel consumed for changing the thermodynamic state of the fluid)." + }, + "WorkingPressure": { + "description": "Boiler working pressure." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_boilerphistory.htm" + }, + "Pset_BoilerTypeCommon": { + "properties": { + "EnergySource": { + "description": "Enumeration defining the energy source or fuel cumbusted to generate heat." + }, + "HeatTransferSurfaceArea": { + "description": "Total heat transfer area of the vessel." + }, + "IsWaterStorageHeater": { + "description": "This is used to identify if the boiler has storage capacity (TRUE). If FALSE, then there is no storage capacity built into the boiler, such as an instantaneous hot water heater." + }, + "NominalEnergyConsumption": { + "description": "Nominal fuel consumption rate required to produce the total boiler heat output." + }, + "NominalPartLoadRatio": { + "description": "Allowable part load ratio range." + }, + "OperatingMode": { + "description": "Identifies the operating mode of the boiler." + }, + "OutletTemperatureRange": { + "description": "Allowable outlet temperature of either the water or the steam." + }, + "PartialLoadEfficiencyCurves": { + "description": "Boiler efficiency as a function of the partial load factor; E = f (partialLaodfactor)." + }, + "PressureRating": { + "description": "Nominal pressure rating of the boiler as rated by the agency having jurisdiction." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "WaterInletTemperatureRange": { + "description": "Allowable water inlet temperature range." + }, + "WaterStorageCapacity": { + "description": "Water storage capacity." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_boilertypecommon.htm" + }, + "Pset_BoilerTypeSteam": { + "properties": { + "HeatOutput": { + "description": "Total nominal heat output as listed by the Boiler manufacturer. For steam boilers, it is a function of inlet temperature versus steam pressure. Note: as two variables are used, DefiningValues and DefinedValues are null, and values are stored in IfcTable in the following order: InletTemperature(IfcThermodynamicTemperatureMeasure) and OutletTemperature(IfcThermodynamicTemperatureMeasure) in DefiningValues, and HeatOutput(IfcEnergyMeasure) in DefinedValues. For example, DefiningValues(InletTemp, OutletTemp), DefinedValues(null, HeatOutput). The IfcTable is related to IfcPropertyTableValue using IfcMetric and IfcPropertyConstraintRelationship." + }, + "MaximumOutletPressure": { + "description": "Maximum steam outlet pressure." + }, + "NominalEfficiency": { + "description": "The nominal efficiency of the boiler as defined by the manufacturer. For steam boilers, a function of inlet temperature versus steam pressure. Note: as two variables are used, DefiningValues and DefinedValues are null, and values are stored in IfcTable in the following order: InletTemperature(IfcThermodynamicTemperatureMeasure) and OutletTemperature(IfcThermodynamicTemperatureMeasure) in DefiningValues, and NominalEfficiency(IfcNormalisedRatioMeasure) in DefinedValues. For example, DefininfValues(InletTemp, OutletTemp), DefinedValues(null, NominalEfficiency). The IfcTable is related to IfcPropertyTableValue using IfcMetric and IfcPropertyConstraintRelationship." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_boilertypesteam.htm" + }, + "Pset_BoilerTypeWater": { + "properties": { + "HeatOutput": { + "description": "Total nominal heat output as listed by the Boiler manufacturer. For water boilers, it is a function of inlet versus outlet temperature. For steam boilers, it is a function of inlet temperature versus steam pressure. Note: as two variables are used, DefiningValues and DefinedValues are null, and values are stored in IfcTable in the following order: InletTemperature(IfcThermodynamicTemperatureMeasure), OutletTemperature(IfcThermodynamicTemperatureMeasure), HeatOutput(IfcEnergyMeasure). The IfcTable is related to IfcPropertyTableValue using IfcMetric and IfcPropertyConstraintRelationship." + }, + "NominalEfficiency": { + "description": "The nominal efficiency of the boiler as defined by the manufacturer. For water boilers, a function of inlet versus outlet temperature. Note: as two variables are used, DefiningValues and DefinedValues are null, and values are stored in IfcTable in the following order: InletTemperature(IfcThermodynamicTemperatureMeasure), OutletTemperature(IfcThermodynamicTemperatureMeasure), NominalEfficiency(IfcNormalizedRatioMeasure). The IfcTable is related to IfcPropertyTableValue using IfcMetric and IfcPropertyConstraintRelationship." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_boilertypewater.htm" + }, + "Pset_BuildingCommon": { + "properties": { + "BuildingID": { + "description": "A unique identifier assigned to a building. A temporary identifier is initially assigned at the time of making a planning application. This temporary identifier is changed to a permanent identifier when the building is registered into a statutory buildings and properties database." + }, + "ConstructionMethod": { + "description": "The type of construction action to the building, the project deals with, e.g. new construction, renovation, refurbishment, etc." + }, + "FireProtectionClass": { + "description": "Main fire protection class for the building which is assigned from the fire protection classification table as given by the relevant national building code." + }, + "GrossPlannedArea": { + "description": "Total planned gross area for the building Used for programming the building." + }, + "IsLandmarked": { + "description": "This builing is listed as a historic building (TRUE), or not (FALSE), or unknown." + }, + "IsPermanentID": { + "description": "Indicates whether the identity assigned to a building is permanent (= TRUE) or temporary (=FALSE)." + }, + "NetPlannedArea": { + "description": "Total planned net area for the building Used for programming the building." + }, + "NumberOfStoreys": { + "description": "The number of storeys within a building. Captured for those cases where the IfcBuildingStorey entity is not used. Note that if IfcBuilingStorey is asserted and the number of storeys in a building can be determined from it, then this approach should be used in preference to setting a property for the number of storeys." + }, + "OccupancyType": { + "description": "Occupancy type for this object. It is defined according to the presiding national building code." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal project type." + }, + "SprinklerProtection": { + "description": "Indication whether this object is sprinkler protected (TRUE) or not (FALSE)." + }, + "SprinklerProtectionAutomatic": { + "description": "Indication whether this object has an automatic sprinkler protection (TRUE) or not (FALSE)." + }, + "YearOfConstruction": { + "description": "Year of construction of this building, including expected year of completion." + }, + "YearOfLastRefurbishment": { + "description": "Year of last major refurbishment, or reconstruction, of the building (applies to reconstruction works)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_buildingcommon.htm" + }, + "Pset_BuildingElementCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for the element. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of an element." + } + } + }, + "Pset_BuildingElementProxyCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for the element. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of the element. It is the total thermal transmittance coefficient through the building element proxy within the direction of the thermal flow (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_buildingelementproxycommon.htm" + }, + "Pset_BuildingElementProxyProvisionForVoid": { + "properties": { + "Depth": { + "description": "The requested depth or thickness of the provision for void." + }, + "Diameter": { + "description": "The requested diameter (in elevation) of the provision for void, only provided if the Shape property is set to \"round\"." + }, + "Height": { + "description": "The requested height (vertical extension in elevation) of the provision for void\", only provided if the Shape property is set to \"rectangle\"." + }, + "Shape": { + "description": "The shape form of the provision for void, the minimum set of agreed values includes 'Rectangle', 'Round', and 'Undefined'." + }, + "System": { + "description": "he building service system that requires the provision for voids, e.g. 'Air Conditioning', 'Plumbing', 'Electro', etc." + }, + "Width": { + "description": "The requested width (horizontal extension in elevation) of the provision for void, only provided if the Shape property is set to \"rectangle\"." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_buildingelementproxyprovisionforvoid.htm" + }, + "Pset_BuildingStoreyCommon": { + "properties": { + "AboveGround": { + "description": "Indication whether this building storey is fully above ground (TRUE), or below ground (FALSE), or partially above and below ground (UNKNOWN) - as in sloped terrain." + }, + "EntranceLevel": { + "description": "Indication whether this building storey is an entrance level to the building (TRUE), or (FALSE) if otherwise." + }, + "GrossPlannedArea": { + "description": "Total planned area for the building storey. Used for programming the building storey." + }, + "LoadBearingCapacity": { + "description": "Maximum load bearing capacity of the floor structure throughtout the storey as designed." + }, + "NetPlannedArea": { + "description": "Total planned net area for the building storey. Used for programming the building storey." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal project type." + }, + "SprinklerProtection": { + "description": "Indication whether this object is sprinkler protected (TRUE) or not (FALSE)." + }, + "SprinklerProtectionAutomatic": { + "description": "Indication whether this object has an automatic sprinkler protection (TRUE) or not (FALSE). It should only be given, if the property \"SprinklerProtection\" is set to TRUE." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_buildingstoreycommon.htm" + }, + "Pset_BuildingSystemCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified instance of building system in this project (e.g. 'TRA/EL1'), The reference values depend on the local code of practice." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_buildingsystemcommon.htm" + }, + "Pset_BuildingUse": { + "properties": { + "MarketCategory": { + "description": "Category of use e.g. residential, commercial, recreation etc." + }, + "MarketSubCategoriesAvailableFuture": { + "description": "A list of the sub categories of property that are expected to be available in the future expressed in terms of IfcLabel." + }, + "MarketSubCategoriesAvailableNow": { + "description": "A list of the sub categories of property that are currently available expressed in terms of IfcLabel." + }, + "MarketSubCategory": { + "description": "Subset of category of use e.g. multi-family, 2 bedroom, low rise." + }, + "NarrativeText": { + "description": "Added information relating to the adjacent building use that is not appropriate to the general descriptive text associated with an entity through the inherited IfcRoot.Description." + }, + "PlanningControlStatus": { + "description": "Label of zoning category or class, or planning control category for the site or facility." + }, + "RentalRatesInCategoryFuture": { + "description": "Range of the cost rates for property expected to be available in the future in the required category." + }, + "RentalRatesInCategoryNow": { + "description": "Range of the cost rates for property currently available in the required category." + }, + "TenureModesAvailableFuture": { + "description": "A list of the tenure modes that are expected to be available in the future expressed in terms of IfcLabel." + }, + "TenureModesAvailableNow": { + "description": "A list of the tenure modes that are currently available expressed in terms of IfcLabel." + }, + "VacancyRateInCategoryFuture": { + "description": "Percentage of vacancy found in the particular category expected in the future." + }, + "VacancyRateInCategoryNow": { + "description": "Percentage of vacancy found in the particular category currently." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_buildinguse.htm" + }, + "Pset_BuildingUseAdjacent": { + "properties": { + "MarketCategory": { + "description": "Category of use e.g. residential, commercial, recreation etc." + }, + "MarketSubCategory": { + "description": "Subset of category of use e.g. multi-family, 2 bedroom, low rise." + }, + "NarrativeText": { + "description": "Added information relating to the adjacent building use that is not appropriate to the general descriptive text associated with an entity through the inherited IfcRoot.Description." + }, + "PlanningControlStatus": { + "description": "Label of zoning category or class, or planning control category for the site or facility." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_buildinguseadjacent.htm" + }, + "Pset_BurnerTypeCommon": { + "properties": { + "EnergySource": { + "description": "Enumeration defining the energy source or fuel cumbusted to generate heat." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_burnertypecommon.htm" + }, + "Pset_CableCarrierFittingTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarrierfittingtypecommon.htm" + }, + "Pset_CableCarrierSegmentTypeCableLadderSegment": { + "properties": { + "LadderConfiguration": { + "description": "Description of the configuration of the ladder structure used." + }, + "NominalHeight": { + "description": "The nominal height of the segment." + }, + "NominalWidth": { + "description": "The nominal width of the segment." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarriersegmenttypecableladdersegment.htm" + }, + "Pset_CableCarrierSegmentTypeCableTraySegment": { + "properties": { + "HasCover": { + "description": "Indication of whether the cable tray has a cover (=TRUE) or not (= FALSE). By default, this value should be set to FALSE.." + }, + "NominalHeight": { + "description": "The nominal height of the segment." + }, + "NominalWidth": { + "description": "The nominal width of the segment." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarriersegmenttypecabletraysegment.htm" + }, + "Pset_CableCarrierSegmentTypeCableTrunkingSegment": { + "properties": { + "NominalHeight": { + "description": "The nominal height of the segment." + }, + "NominalWidth": { + "description": "The nominal width of the segment." + }, + "NumberOfCompartments": { + "description": "The number of separate internal compartments within the trunking." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarriersegmenttypecabletrunkingsegment.htm" + }, + "Pset_CableCarrierSegmentTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarriersegmenttypecommon.htm" + }, + "Pset_CableCarrierSegmentTypeConduitSegment": { + "properties": { + "ConduitShapeType": { + "description": "The shape of the conduit segment." + }, + "IsRigid": { + "description": "Indication of whether the conduit is rigid (= TRUE) or flexible (= FALSE)." + }, + "NominalHeight": { + "description": "The nominal height of the segment." + }, + "NominalWidth": { + "description": "The nominal width of the segment." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablecarriersegmenttypeconduitsegment.htm" + }, + "Pset_CableFittingTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablefittingtypecommon.htm" + }, + "Pset_CableSegmentOccurrence": { + "properties": { + "CarrierStackNumber": { + "description": "Number of carrier segments (tray, ladder etc.) that are vertically stacked (vertical is measured as the z-axis of the local coordinate system of the carrier segment)." + }, + "CurrentCarryingCapasity": { + "description": "Maximum value of electric current which can be carried continuously by a conductor, a device or an apparatus, under specified conditions without its steady-state temperature exceeding a specified value. Based on IEC60826-11-13. NOTE: The temperature specified value is maximum Design Ambient Temperature." + }, + "DesignAmbientTemperature": { + "description": "The highest and lowest local ambient temperature likely to be encountered." + }, + "DistanceBetweenParallelCircuits": { + "description": "Distance measured between parallel circuits." + }, + "InstallationMethod": { + "description": "Method of installation of cable/conductor. Installation methods are typically defined by reference in standards such as IEC 60364-5-52, table 52A-1 or BS7671 Appendix 4 Table 4A1 etc. Selection of the value to be used should be determined from such a standard according to local usage." + }, + "InstallationMethodFlagEnum": { + "description": "Special installation conditions relating to particular types of installation based on IEC60364-5-52:2001 reference installation methods C and D." + }, + "IsHorizontalCable": { + "description": "Indication of whether the cable occurrences are mounted horizontally (= TRUE) or vertically (= FALSE)." + }, + "IsMountedFlatCable": { + "description": "Indication of whether the cable occurrences are mounted flat (= TRUE) or in a trefoil pattern (= FALSE)." + }, + "MaximumCableLength": { + "description": "Maximum cable length based on voltagedrop. NOTE: This value may also be specified as a constraint within an IFC model if required but is included within the property set at this stage pending implementation of the required capabilities within software applications." + }, + "MountingMethod": { + "description": "The method of mounting cable segment occurrences on a cable carrier occurrence from which the method required can be selected. This is for the purpose of carrying out 'worst case' cable sizing calculations and may be a conceptual requirement rather than a statement of the physical occurrences of cable and carrier segments." + }, + "NumberOfParallelCircuits": { + "description": "Number of parallel circuits." + }, + "PowerLoss": { + "description": "Total loss of power across this cable." + }, + "SoilConductivity": { + "description": "Thermal conductivity of soil. Generally, within standards such as IEC 60364-5-52, table 52A-16, the resistivity of soil is required (measured in [SI] units of degK.m /W). This is the reciprocal of the conductivity value and needs to be calculated accordingly." + }, + "UserCorrectionFactor": { + "description": "An arbitrary correction factor that may be applied by the user." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmentoccurrence.htm" + }, + "Pset_CableSegmentTypeBusBarSegment": { + "properties": { + "IsHorizontalBusbar": { + "description": "Indication of whether the busbar occurrences are routed horizontally (= TRUE) or vertically (= FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmenttypebusbarsegment.htm" + }, + "Pset_CableSegmentTypeCableSegment": { + "properties": { + "FunctionReliable": { + "description": "Cable/bus maintain given properties/functions over a given (tested) time and conditions. According to IEC standard." + }, + "HalogenProof": { + "description": "Produces small amount of smoke and irritating Deaerator/Gas." + }, + "HasProtectiveEarth": { + "description": "One core has protective earth marked insulation, Yellow/Green." + }, + "MaximumOperatingTemperature": { + "description": "The maximum temperature at which a cable or bus is certified to operate." + }, + "MaximumShortCircuitTemperature": { + "description": "The maximum short circuit temperature at which a cable or bus is certified to operate." + }, + "NumberOfCores": { + "description": "The number of cores in Cable/Bus." + }, + "OverallDiameter": { + "description": "The overall diameter of a Cable/Bus." + }, + "RatedTemperature": { + "description": "The range of allowed temerature that a device is certified to handle. The upper bound of this value is the maximum." + }, + "RatedVoltage": { + "description": "The range of allowed voltage that a device is certified to handle. The upper bound of this value is the maximum." + }, + "ScreenDiameter": { + "description": "The diameter of the screen around a cable or bus segment (if present)." + }, + "SelfExtinguishing60332_1": { + "description": "Self Extinguishing cable/core according to IEC 60332.1." + }, + "SelfExtinguishing60332_3": { + "description": "Self Extinguishing cable/core according to IEC 60332.3." + }, + "SpecialConstruction": { + "description": "Special construction capabilities like self-supporting, flat devidable cable or bus flat non devidable cable or bus supporting elements inside (steal, textile, concentric conductor). Note that materials used should be agreed between exchange participants before use." + }, + "Standard": { + "description": "The designation of the standard applicable for the definition of the Cable/Bus used." + }, + "Weight": { + "description": "Weight of cable kg/km." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmenttypecablesegment.htm" + }, + "Pset_CableSegmentTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmenttypecommon.htm" + }, + "Pset_CableSegmentTypeConductorSegment": { + "properties": { + "Construction": { + "description": "Purpose of informing on how the vonductor is constucted (interwined or solid). I.e. Solid (IEV 461-01-06), stranded (IEV 461-01-07), solid-/finestranded(IEV 461-01-11) (not flexible/flexible)." + }, + "CrossSectionalArea": { + "description": "Cross section area of the phase(s) lead(s)." + }, + "Function": { + "description": "Type of function for which the conductor is intended." + }, + "Material": { + "description": "Type of material from which the conductor is constructed." + }, + "Shape": { + "description": "Indication of the shape of the conductor." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmenttypeconductorsegment.htm" + }, + "Pset_CableSegmentTypeCoreSegment": { + "properties": { + "CoreIdentifier": { + "description": "The core identification used Identifiers may be used such as by color (Black, Brown, Grey) or by number (1, 2, 3) or by IEC phase reference (L1, L2, L3) etc." + }, + "FunctionReliable": { + "description": "Core maintain given properties/functions over a given (tested) time and conditions. According to (IEC) standard." + }, + "HalogenProof": { + "description": "Produces small amount of smoke and irritating deaerator/gas." + }, + "OverallDiameter": { + "description": "The overall diameter of a core (maximun space used)." + }, + "RatedTemperature": { + "description": "The range of allowed temerature that a device is certified to handle. The upper bound of this value is the maximum." + }, + "RatedVoltage": { + "description": "The range of allowed voltage that a device is certified to handle. The upper bound of this value is the maximum." + }, + "ScreenDiameter": { + "description": "The diameter of the screen around a core segment (if present)." + }, + "SelfExtinguishing60332_1": { + "description": "Self Extinguishing cable/core according to IEC 60332.1." + }, + "SelfExtinguishing60332_3": { + "description": "Self Extinguishing cable/core according to IEC 60332.3." + }, + "SheathColors": { + "description": "Colour of the core (derived from IEC 60757). Note that the combined color 'GreenAndYellow' shall be used only as Protective Earth (PE) conductors according to the requirements of IEC 60446." + }, + "Standard": { + "description": "The designation of the standard applicable for the definition of the core used." + }, + "Weight": { + "description": "Weight of core kg/km." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_cablesegmenttypecoresegment.htm" + }, + "Pset_ChillerPHistory": { + "properties": { + "Capacity": { + "description": "The product of the ideal capacity and the overall volumetric efficiency of the compressor." + }, + "CoefficientOfPerformance": { + "description": "The Coefficient of performance (COP) is the ratio of heat removed to energy input. The energy input may be obtained by multiplying Pset_DistributionPortPHistoryGas.FlowRate on the 'Fuel' port of the IfcChiller by Pset_MaterialFuel.LowerHeatingValue. The IfcDistributionPort for fuel has an associated IfcMaterial with fuel properties and is assigned to an IfcPerformanceHistory object nested within this IfcPerformanceHistory object." + }, + "EnergyEfficiencyRatio": { + "description": "The Energy efficiency ratio (EER) is the ratio of net cooling capacity to the total input rate of electric power applied. By definition, the units are BTU/hour per Watt. The input electric power may be obtained from Pset_DistributionPortPHistoryElectrical.RealPower on the 'Power' port of the IfcChiller." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_chillerphistory.htm" + }, + "Pset_ChillerTypeCommon": { + "properties": { + "CapacityCurve": { + "description": "Chiller cooling capacity is a function of condensing temperature and evaporating temperature, data is in table form, Capacity = f (TempCon, TempEvp), capacity = a1+b1*Tei+c1*Tei\\^2+d1*Tci+e1*Tci\\^2+f1*Tei*Tci. This table uses multiple input variables; to represent, both DefiningValues and DefinedValues lists are null and IfcTable is attached using IfcPropertyConstraintRelationship and IfcMetric. Columns are specified in the following order: 1.IfcPowerMeasure:Capacity 2.IfcThermodynamicTemperatureMeasure:CondensingTemperature 3.IfcThermodynamicTemperatureMeasure:EvaporatingTemperature" + }, + "CoefficientOfPerformanceCurve": { + "description": "Chiller coefficient of performance (COP) is function of condensing temperature and evaporating temperature, data is in table form, COP= f (TempCon, TempEvp), COP = a2+b2*Tei+c2*Tei\\^2+d2*Tci+e2*Tci\\^2+f2*Tei*Tci. This table uses multiple input variables; to represent, both DefiningValues and DefinedValues lists are null and IfcTable is attached using IfcPropertyConstraintRelationship and IfcMetric. Columns are specified in the following order: 1.IfcPositiveRatioMeasure:CoefficientOfPerformance 2.IfcThermodynamicTemperatureMeasure:CondensingTemperature 3.IfcThermodynamicTemperatureMeasure:EvaporatingTemperature" + }, + "FullLoadRatioCurve": { + "description": "Ratio of actual power to full load power as a quadratic function of part load, at certain condensing and evaporating temperature, FracFullLoadPower = f ( PartLoadRatio)." + }, + "NominalCapacity": { + "description": "Nominal cooling capacity of chiller at standardized conditions as defined by the agency having jurisdiction." + }, + "NominalCondensingTemperature": { + "description": "Chiller condensing temperature." + }, + "NominalEfficiency": { + "description": "Nominal chiller efficiency under nominal conditions." + }, + "NominalEvaporatingTemperature": { + "description": "Chiller evaporating temperature." + }, + "NominalHeatRejectionRate": { + "description": "Sum of the refrigeration effect and the heat equivalent of the power input to the compressor." + }, + "NominalPowerConsumption": { + "description": "Nominal total power consumption." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_chillertypecommon.htm" + }, + "Pset_ChimneyCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for the element. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "NumberOfDrafts": { + "description": "Number of the chimney drafts, continuous holes in the chimney through which the air passes, within the single chimney." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of an element. Here the total thermal transmittance coefficient through the chimney within the direction of the thermal flow (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_chimneycommon.htm" + }, + "Pset_CivilElementCommon": { + "properties": { + "Reference": {}, + "Status": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_civilelementcommon.htm" + }, + "Pset_CoilOccurrence": { + "properties": { + "HasSoundAttenuation": { + "description": "TRUE if the coil has sound attenuation, FALSE if it does not." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coiloccurrence.htm" + }, + "Pset_CoilPHistory": { + "properties": { + "AirPressureDropCurve": { + "description": "Air pressure drop curve, pressure drop \u2013 flow rate curve, AirPressureDrop = f (AirflowRate)." + }, + "AtmosphericPressure": { + "description": "Ambient atmospheric pressure." + }, + "FaceVelocity": { + "description": "Air velocity through the coil." + }, + "SoundCurve": { + "description": "Regenerated sound versus air-flow rate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coilphistory.htm" + }, + "Pset_CoilTypeCommon": { + "properties": { + "AirflowRateRange": { + "description": "Possible range of airflow that can be delivered. For cases where there is no airflow across the coil (e.g. electric coil in a floor slab), then the value is zero." + }, + "NominalLatentCapacity": { + "description": "Nominal latent capacity." + }, + "NominalSensibleCapacity": { + "description": "Nominal sensible capacity." + }, + "NominalUA": { + "description": "Nominal UA value." + }, + "OperationalTemperatureRange": { + "description": "Allowable operational air temperature range." + }, + "PlacementType": { + "description": "Indicates the placement of the coil. FLOOR indicates an under floor heater (if coil type is WATERHEATINGCOIL or ELECTRICHEATINGCOIL); CEILING indicates a cooling ceiling (if coil type is WATERCOOLINGCOIL); UNIT indicates that the coil is part of a cooling or heating unit, like cooled beam, etc." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coiltypecommon.htm" + }, + "Pset_CoilTypeHydronic": { + "properties": { + "BypassFactor": { + "description": "Fraction of air that is bypassed by the coil (0-1)." + }, + "CoilConnectionDirection": { + "description": "Coil connection direction (facing into the air stream)." + }, + "CoilCoolant": { + "description": "The fluid used for heating or cooling used by the hydronic coil." + }, + "CoilFaceArea": { + "description": "Coil face area in the direction against air the flow." + }, + "CoilFluidArrangement": { + "description": "Fluid flow arrangement of the coil." + }, + "FluidPressureRange": { + "description": "Allowable water working pressure range inside the tube." + }, + "HeatExchangeSurfaceArea": { + "description": "Heat exchange surface area associated with U-value." + }, + "PrimarySurfaceArea": { + "description": "Primary heat transfer surface area of the tubes and headers." + }, + "SecondarySurfaceArea": { + "description": "Secondary heat transfer surface area created by fins." + }, + "SensibleHeatRatio": { + "description": "Air-side sensible heat ratio, or fraction of sensible heat transfer to the total heat transfer." + }, + "TotalUACurves": { + "description": "Total UA curves, UA - air and water velocities, UA = [(C1 * AirFlowRate\\^0.8)\\^-1 + (C2 * WaterFlowRate\\^0.8)\\^-1]\\^-1. Note: as two variables are used, DefiningValues and DefinedValues are null, and values are stored in IfcTable in the following order: AirFlowRate,WaterFlowRate,UA. The IfcTable is related to IfcPropertyTableValue using IfcMetric and IfcPropertyConstraintRelationship." + }, + "WaterPressureDropCurve": { + "description": "Water pressure drop curve, pressure drop \u2013 flow rate curve, WaterPressureDrop = f(WaterflowRate)." + }, + "WetCoilFraction": { + "description": "Fraction of coil surface area that is wet (0-1)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coiltypehydronic.htm" + }, + "Pset_ColumnCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for the element. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Roll": { + "description": "Rotation against the longitudinal axis - relative to the global X direction for all columns that are vertical in regard to the global coordinate system (Profile direction equals global X is Roll = 0.). For all non-vertical columns the following applies: Roll is relative to the global Z direction f(Profile direction of non-vertical columns that equals global Z is Roll = 0.)" + }, + "Slope": { + "description": "Slope angle - relative to horizontal (0.0 degrees)." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of the element. Here the total thermal transmittance coefficient through the column within the direction of the thermal flow (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_columncommon.htm" + }, + "Pset_CommunicationsAppliancePHistory": { + "properties": { + "PowerState": { + "description": "Indicates the power state of the device where True is on and False is off." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_communicationsappliancephistory.htm" + }, + "Pset_CommunicationsApplianceTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_communicationsappliancetypecommon.htm" + }, + "Pset_CompressorPHistory": { + "properties": { + "CoefficientOfPerformance": { + "description": "Coefficient of performance (COP)." + }, + "CompressionEfficiency": { + "description": "Ratio of the work required for isentropic compression of the gas to the work delivered to the gas within the compression volume (as obtained by measurement)." + }, + "CompressorCapacity": { + "description": "The product of the ideal capacity and the overall volumetric efficiency of the compressor." + }, + "CompressorTotalEfficiency": { + "description": "Ratio of the thermal cooling capacity to electrical input." + }, + "CompressorTotalHeatGain": { + "description": "Compressor total heat gain." + }, + "EnergyEfficiencyRatio": { + "description": "Energy efficiency ratio (EER)." + }, + "FrictionHeatGain": { + "description": "Friction heat gain." + }, + "FullLoadRatio": { + "description": "Ratio of actual power to full load power as a quadratic function of part load, at certain condensing and evaporating temperature, FracFullLoadPower = f ( PartLoadRatio)." + }, + "InputPower": { + "description": "Input power to the compressor motor." + }, + "IsentropicEfficiency": { + "description": "Ratio of the work required for isentropic compression of the gas to work input to the compressor shaft." + }, + "LubricantPumpHeatGain": { + "description": "Lubricant pump heat gain." + }, + "MechanicalEfficiency": { + "description": "Ratio of the work (as measured) delivered to the gas to the work input to the compressor shaft." + }, + "ShaftPower": { + "description": "The actual shaft power input to the compressor." + }, + "VolumetricEfficiency": { + "description": "Ratio of the actual volume of gas entering the compressor to the theoretical displacement of the compressor." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_compressorphistory.htm" + }, + "Pset_CompressorTypeCommon": { + "properties": { + "CompressorSpeed": { + "description": "Compressor speed." + }, + "HasHotGasBypass": { + "description": "Whether or not hot gas bypass is provided for the compressor. TRUE = Yes, FALSE = No." + }, + "IdealCapacity": { + "description": "Compressor capacity under ideal conditions." + }, + "IdealShaftPower": { + "description": "Compressor shaft power under ideal conditions." + }, + "ImpellerDiameter": { + "description": "Diameter of compressor impeller - used to scale performance of geometrically similar compressors." + }, + "MaximumPartLoadRatio": { + "description": "Maximum part load ratio as a fraction of nominal capacity." + }, + "MinimumPartLoadRatio": { + "description": "Minimum part load ratio as a fraction of nominal capacity." + }, + "NominalCapacity": { + "description": "Compressor nameplate capacity." + }, + "PowerSource": { + "description": "Type of power driving the compressor." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "RefrigerantClass": { + "description": "Refrigerant class used by the compressor." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_compressortypecommon.htm" + }, + "Pset_ConcreteElementGeneral": { + "properties": { + "ConcreteCover": { + "description": "The protective concrete cover at the reinforcing bars according to local building regulations." + }, + "ConcreteCoverAtLinks": { + "description": "The protective concrete cover at the reinforcement links according to local building regulations." + }, + "ConcreteCoverAtMainBars": { + "description": "The protective concrete cover at the main reinforcing bars according to local building regulations." + }, + "ConstructionMethod": { + "description": "Designator for whether the concrete element is constructed on site or prefabricated. Allowed values are: 'In-Situ' vs 'Precast'." + }, + "ConstructionToleranceClass": { + "description": "Classification designation of the on-site construction tolerances according to local standards." + }, + "DimensionalAccuracyClass": { + "description": "Classification designation of the dimensional accuracy requirement according to local standards." + }, + "ExposureClass": { + "description": "Classification of exposure to environmental conditions, usually specified in accordance with the concrete design code which is applied in the project." + }, + "ReinforcementAreaRatio": { + "description": "The required ratio of the effective area of the reinforcement to the effective area of the concrete At any section of a reinforced concrete structural element." + }, + "ReinforcementStrengthClass": { + "description": "Classification of the reinforcement strength in accordance with the concrete design code which is applied in the project. The reinforcing strength class often combines strength and ductility." + }, + "ReinforcementVolumeRatio": { + "description": "The required ratio of the effective mass of the reinforcement to the effective volume of the concrete of a reinforced concrete structural element." + }, + "StrengthClass": { + "description": "Classification of the concrete strength in accordance with the concrete design code which is applied in the project." + }, + "StructuralClass": { + "description": "The structural class defined for the concrete structure (e.g. '1')." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_concreteelementgeneral.htm" + }, + "Pset_CondenserPHistory": { + "properties": { + "CompressorCondenserHeatGain": { + "description": "Heat gain between condenser inlet to compressor outlet." + }, + "CompressorCondenserPressureDrop": { + "description": "Pressure drop between condenser inlet and compressor outlet." + }, + "CondenserMeanVoidFraction": { + "description": "Mean void fraction in condenser." + }, + "CondensingTemperature": { + "description": "Refrigerant condensing temperature." + }, + "ExteriorHeatTransferCoefficient": { + "description": "Exterior heat transfer coefficient associated with exterior surface area." + }, + "HeatRejectionRate": { + "description": "Sum of the refrigeration effect and the heat equivalent of the power input to the compressor." + }, + "InteriorHeatTransferCoefficient": { + "description": "Interior heat transfer coefficient associated with interior surface area." + }, + "LogarithmicMeanTemperatureDifference": { + "description": "Logarithmic mean temperature difference between refrigerant and water or air." + }, + "RefrigerantFoulingResistance": { + "description": "Fouling resistance on the refrigerant side." + }, + "UAcurves": { + "description": "UV = f (VExterior, VInterior), UV as a function of interior and exterior fluid flow velocity at the entrance." + }, + "WaterFoulingResistance": { + "description": "Fouling resistance on water/air side." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_condenserphistory.htm" + }, + "Pset_CondenserTypeCommon": { + "properties": { + "ExternalSurfaceArea": { + "description": "External surface area (both primary and secondary area)." + }, + "InternalRefrigerantVolume": { + "description": "Internal volume of condenser (refrigerant side)." + }, + "InternalSurfaceArea": { + "description": "Internal surface area." + }, + "InternalWaterVolume": { + "description": "Internal volume of condenser (water side)." + }, + "NominalHeatTransferArea": { + "description": "Nominal heat transfer surface area associated with nominal overall heat transfer coefficient." + }, + "NominalHeatTransferCoefficient": { + "description": "Nominal overall heat transfer coefficient associated with nominal heat transfer area." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "RefrigerantClass": { + "description": "Refrigerant class used by the condenser." + }, + "Status": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_condensertypecommon.htm" + }, + "Pset_Condition": { + "properties": { + "AssessmentCondition": { + "description": "The overall condition of a product based on an assessment of the contributions to the overall condition made by the various criteria considered. The meanings given to the values of assessed condition should be agreed and documented by local agreements. For instance, is overall condition measured on a scale of 1 - 10 or by assigning names such as Good, OK, Poor." + }, + "AssessmentDate": { + "description": "Date on which the overall condition is assessed" + }, + "AssessmentDescription": { + "description": "Qualitative description of the condition." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_condition.htm" + }, + "Pset_ConstructionResource": { + "properties": { + "ActualCompletion": { + "description": "The actual completion percentage of the allocation." + }, + "ActualCost": { + "description": "The actual cost on behalf of the resource allocation." + }, + "ActualWork": { + "description": "The actual work on behalf of the resource allocation." + }, + "RemainingCost": { + "description": "The remaining cost on behalf of the resource allocation." + }, + "RemainingWork": { + "description": "The remaining work on behalf of the resource allocation." + }, + "ScheduleCompletion": { + "description": "The scheduled completion percentage of the allocation." + }, + "ScheduleCost": { + "description": "The budgeted cost on behalf of the resource allocation." + }, + "ScheduleWork": { + "description": "The scheduled work on behalf of the resource allocation." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/pset/pset_constructionresource.htm" + }, + "Pset_ControllerPHistory": { + "properties": { + "Quality": { + "description": "Indicates the quality of measurement or failure condition, which may be further qualified by the Status. True: measured values are considered reliable; False: measured values are considered not reliable (i.e. a fault has been detected); Unknown: reliability of values is uncertain." + }, + "Status": { + "description": "Indicates an error code or identifier, whose meaning is specific to the particular automation system. Example values include: 'ConfigurationError', 'NotConnected', 'DeviceFailure', 'SensorFailure', 'LastKnown, 'CommunicationsFailure', 'OutOfService'." + }, + "Value": { + "description": "Indicates values over time which may be recorded continuously or only when changed beyond a particular deadband. The range of possible values is defined by the Value property on the corresponding occurrence property set (Pset_ControllerTypeFloating, Pset_ControllerTypeProportional, Pset_ControllerTypeMultiPosition, or Pset_ControllerTypeTwoPosition)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllerphistory.htm" + }, + "Pset_ControllerTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypecommon.htm" + }, + "Pset_ControllerTypeFloating": { + "properties": { + "ControlType": { + "description": "The type of signal modification effected and applicable ports: " + }, + "Labels": { + "description": "Table mapping values to labels, where such labels indicate transition points such as 'Hi', 'Lo', 'HiHi', or 'LoLo'." + }, + "Range": { + "description": "The physical range of values supported by the device." + }, + "SignalFactor": { + "description": "Factor multiplied onto offset signal." + }, + "SignalOffset": { + "description": "Offset constant added to modfied signal." + }, + "SignalTime": { + "description": "Time factor used for integral and running average controllers." + }, + "Value": { + "description": "The expected range and default value. While the property data type is IfcReal (to support all cases including when the units are unknown), a unit may optionally be provided to indicate the measure and unit. The LowerLimitValue and UpperLimitValue must fall within the physical Range and may be used to determine extents when charting Pset_ControllerPHistory.Value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypefloating.htm" + }, + "Pset_ControllerTypeMultiPosition": { + "properties": { + "ControlType": { + "description": "The type of signal modification effected and applicable ports:" + }, + "Labels": { + "description": "Table mapping values to labels, where each entry corresponds to an integer within the ValueRange." + }, + "Range": { + "description": "The physical range of values supported by the device." + }, + "Value": { + "description": "The expected range and default value. The LowerLimitValue and UpperLimitValue must fall within the physical Range." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypemultiposition.htm" + }, + "Pset_ControllerTypeProgrammable": { + "properties": { + "Application": { + "description": "Indicates application of controller." + }, + "ControlType": { + "description": "The type of discrete digital controller: " + }, + "FirmwareVersion": { + "description": "Indicates version of device firmware according to device manufacturer." + }, + "SoftwareVersion": { + "description": "Indicates version of application software according to systems integrator." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypeprogrammable.htm" + }, + "Pset_ControllerTypeProportional": { + "properties": { + "ControlType": { + "description": "The type of signal modification. PROPORTIONAL: Output is proportional to the control error. The gain of a proportional control (Kp) will have the effect of reducing the rise time and reducing , but never eliminating, the steady-state error of the variable controlled. PROPORTIONALINTEGRAL: Part of the output is proportional to the control error and part is proportional to the time integral of the control error. Adding the gain of an integral control (Ki) will have the effect of eliminating the steady-state error of the variable controlled, but it may make the transient response worse. PROPORTIONALINTEGRALDERIVATIVE: Part of the output is proportional to the control error, part is proportional to the time integral of the control error and part is proportional to the time derivative of the control error. Adding the gain of a derivative control (Kd) will have the effect of increasing the stability of the system, reducing the overshoot, and improving the transient response of the variable controlled." + }, + "DerivativeConstant": { + "description": "The derivative gain factor of the controller (usually referred to as Kd). Asserted where ControlType is PROPORTIONALINTEGRALDERIVATIVE." + }, + "IntegralConstant": { + "description": "The integral gain factor of the controller (usually referred to as Ki). Asserted where ControlType is PROPORTIONALINTEGRAL or PROPORTIONALINTEGRALDERIVATIVE." + }, + "Labels": { + "description": "Table mapping values to labels, where such labels indicate transition points such as 'Hi', 'Lo', 'HiHi', or 'LoLo'." + }, + "ProportionalConstant": { + "description": "The proportional gain factor of the controller (usually referred to as Kp)." + }, + "Range": { + "description": "The physical range of values." + }, + "SignalTimeDecrease": { + "description": "Time factor used for exponential decrease." + }, + "SignalTimeIncrease": { + "description": "Time factor used for exponential increase." + }, + "Value": { + "description": "The expected range and default value. While the property data type is IfcReal (to support all cases including when the units are unknown), a unit may optionally be provided to indicate the measure and unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypeproportional.htm" + }, + "Pset_ControllerTypeTwoPosition": { + "properties": { + "ControlType": { + "description": "The type of signal modification effected and applicable ports:" + }, + "Labels": { + "description": "Table mapping values to labels, where such labels indicate the meanings of True and False, such as 'Open' and 'Closed'" + }, + "Polarity": { + "description": "True indicates normal polarity; False indicates reverse polarity." + }, + "Value": { + "description": "The default value such as normally-closed or normally-open." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_controllertypetwoposition.htm" + }, + "Pset_CooledBeamPHistory": { + "properties": { + "BeamCoolingCapacity": { + "description": "Cooling capacity of beam. This excludes cooling capacity of supply air." + }, + "BeamHeatingCapacity": { + "description": "Heating capacity of beam. This excludes heating capacity of supply air." + }, + "CoolingWaterFlowRate": { + "description": "Water flow rate for cooling." + }, + "CorrectionFactorForCooling": { + "description": "Correction factor k as a function of water flow rate (used to calculate cooling capacity)." + }, + "CorrectionFactorForHeating": { + "description": "Correction factor k as a function of water flow rate (used to calculate heating capacity)." + }, + "HeatingWaterFlowRate": { + "description": "Water flow rate for heating." + }, + "ReturnWaterTemperatureCooling": { + "description": "Return water temperature in cooling mode." + }, + "ReturnWaterTemperatureHeating": { + "description": "Return water temperature in heating mode." + }, + "SupplyWaterTemperatureCooling": { + "description": "Supply water temperature in cooling mode." + }, + "SupplyWaterTemperatureHeating": { + "description": "Supply water temperature in heating mode." + }, + "TotalCoolingCapacity": { + "description": "Total cooling capacity. This includes cooling capacity of beam and cooling capacity of supply air." + }, + "TotalHeatingCapacity": { + "description": "Total heating capacity. This includes heating capacity of beam and heating capacity of supply air." + }, + "WaterPressureDropCurves": { + "description": "Water pressure drop as function of water flow rate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_cooledbeamphistory.htm" + }, + "Pset_CooledBeamPHistoryActive": { + "properties": { + "AirFlowRate": { + "description": "Air flow rate." + }, + "AirPressureDropCurves": { + "description": "Air pressure drop as function of air flow rate." + }, + "Throw": { + "description": "Distance cooled beam throws the air." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_cooledbeamphistoryactive.htm" + }, + "Pset_CooledBeamTypeActive": { + "properties": { + "AirFlowConfiguration": { + "description": "Air flow configuration type of cooled beam." + }, + "AirflowRateRange": { + "description": "Possible range of airflow that can be delivered." + }, + "ConnectionSize": { + "description": "Duct connection diameter." + }, + "SupplyAirConnectionType": { + "description": "The manner in which the pipe connection is made to the cooled beam." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_cooledbeamtypeactive.htm" + }, + "Pset_CooledBeamTypeCommon": { + "properties": { + "CoilLength": { + "description": "Length of coil." + }, + "CoilWidth": { + "description": "Width of coil." + }, + "FinishColor": { + "description": "Finish color for cooled beam." + }, + "IntegratedLightingType": { + "description": "Integrated lighting in cooled beam." + }, + "IsFreeHanging": { + "description": "Is it free hanging type (not mounted in a false ceiling)?" + }, + "NominalCoolingCapacity": { + "description": "Nominal cooling capacity." + }, + "NominalHeatingCapacity": { + "description": "Nominal heating capacity." + }, + "NominalReturnWaterTemperatureCooling": { + "description": "Nominal return water temperature (refers to nominal cooling capacity)." + }, + "NominalReturnWaterTemperatureHeating": { + "description": "Nominal return water temperature (refers to nominal heating capacity)." + }, + "NominalSupplyWaterTemperatureCooling": { + "description": "Nominal supply water temperature (refers to nominal cooling capacity)." + }, + "NominalSupplyWaterTemperatureHeating": { + "description": "Nominal supply water temperature (refers to nominal heating capacity)." + }, + "NominalSurroundingHumidityCooling": { + "description": "Nominal surrounding humidity (refers to nominal cooling capacity)." + }, + "NominalSurroundingTemperatureCooling": { + "description": "Nominal surrounding temperature (refers to nominal cooling capacity)." + }, + "NominalSurroundingTemperatureHeating": { + "description": "Nominal surrounding temperature (refers to nominal heating capacity)." + }, + "NominalWaterFlowCooling": { + "description": "Nominal water flow (refers to nominal cooling capacity)." + }, + "NominalWaterFlowHeating": { + "description": "Nominal water flow (refers to nominal heating capacity)." + }, + "PipeConnection": { + "description": "The manner in which the pipe connection is made to the cooled beam." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "WaterFlowControlSystemType": { + "description": "Factory fitted waterflow control system." + }, + "WaterPressureRange": { + "description": "Allowable water circuit working pressure range." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_cooledbeamtypecommon.htm" + }, + "Pset_CoolingTowerPHistory": { + "properties": { + "Capacity": { + "description": "Cooling tower capacity in terms of heat transfer rate of the cooling tower between air stream and water stream." + }, + "HeatTransferCoefficient": { + "description": "Heat transfer coefficient-area product." + }, + "Performance": { + "description": "Water temperature change as a function of wet-bulb temperature, water entering temperature, water flow rate, air flow rate, Tdiff = f ( Twet-bulb, Twater,in, mwater, mair)." + }, + "SumpHeaterPower": { + "description": "Electrical heat power of sump heater." + }, + "UACurve": { + "description": "UA value as a function of fan speed at certain water flow rate, UA = f ( fan speed)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coolingtowerphistory.htm" + }, + "Pset_CoolingTowerTypeCommon": { + "properties": { + "AmbientDesignDryBulbTemperature": { + "description": "Ambient design dry bulb temperature used for selecting the cooling tower." + }, + "AmbientDesignWetBulbTemperature": { + "description": "Ambient design wet bulb temperature used for selecting the cooling tower." + }, + "BasinReserveVolume": { + "description": "Volume between operating and overflow levels in cooling tower basin." + }, + "CapacityControl": { + "description": "FanCycling: Fan is cycled on and off to control duty. TwoSpeedFan: Fan is switched between low and high speed to control duty. VariableSpeedFan: Fan speed is varied to control duty. DampersControl: Dampers modulate the air flow to control duty. BypassValveControl: Bypass valve modulates the water flow to control duty. MultipleSeriesPumps: Turn on/off multiple series pump to control duty. TwoSpeedPump: Switch between high/low pump speed to control duty. VariableSpeedPump: vary pump speed to control duty." + }, + "CircuitType": { + "description": "OpenCircuit: Exposes water directly to the cooling atmosphere. CloseCircuit: The fluid is separated from the atmosphere by a heat exchanger. Wet: The air stream or the heat exchange surface is evaporatively cooled. Dry: No evaporation into the air stream. DryWet: A combination of a dry tower and a wet tower." + }, + "ControlStrategy": { + "description": "FixedExitingWaterTemp: The capacity is controlled to maintain a fixed exiting water temperature. WetBulbTempReset: The set-point is reset based on the wet-bulb temperature." + }, + "FlowArrangement": { + "description": "CounterFlow: Air and water flow enter in different directions. CrossFlow: Air and water flow are perpendicular. ParallelFlow: air and water flow enter in same directions." + }, + "LiftElevationDifference": { + "description": "Elevation difference between cooling tower sump and the top of the tower." + }, + "NominalCapacity": { + "description": "Nominal cooling tower capacity in terms of heat transfer rate of the cooling tower between air stream and water stream at nominal conditions." + }, + "NumberOfCells": { + "description": "Number of cells in one cooling tower unit." + }, + "OperationTemperatureRange": { + "description": "Allowable operation ambient air temperature range." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "SprayType": { + "description": "SprayFilled: Water is sprayed into airflow. SplashTypeFill: water cascades over successive rows of splash bars. FilmTypeFill: water flows in a thin layer over closely spaced sheets." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "WaterRequirement": { + "description": "Make-up water requirements." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_coolingtowertypecommon.htm" + }, + "Pset_CoveringCeiling": { + "properties": { + "Permeability": { + "description": "Ratio of the permeability of the ceiling. The ration can be used to indicate an open ceiling (that enables identification of whether ceiling construction should be considered as impeding distribution of sprinkler water, light etc. from installations within the ceiling area)." + }, + "TileLength": { + "description": "Length of ceiling tiles. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "TileWidth": { + "description": "Width of ceiling tiles. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_coveringceiling.htm" + }, + "Pset_CoveringCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is giving according to the national building code. It indicates the sound transmission resistance of this object by an index ration (instead of providing full sound absorbtion values)." + }, + "Combustible": { + "description": "Indication whether the object is made from combustible material (TRUE) or not (FALSE)." + }, + "Finish": { + "description": "Finish selection for this object. Here specification of the surface finish for informational purposes." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "FlammabilityRating": { + "description": "Flammability Rating for this object. It is given according to the national building code that governs the rating of flammability for materials." + }, + "FragilityRating": { + "description": "Indication on the fragility of the covering (e.g., under fire conditions). It is given according to the national building code that might provide a classification for fragility." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SurfaceSpreadOfFlame": { + "description": "Indication on how the flames spread around the surface, It is given according to the national building code that governs the fire behaviour for materials." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of an element. Here the total thermal transmittance coefficient through the covering (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_coveringcommon.htm" + }, + "Pset_CoveringFlooring": { + "properties": { + "HasAntiStaticSurface": { + "description": "Indication whether the surface finish is designed to prevent electrostatic charge (TRUE) or not (FALSE)." + }, + "HasNonSkidSurface": { + "description": "Indication whether the surface finish is designed to prevent slippery (TRUE) or not (FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_coveringflooring.htm" + }, + "Pset_CurtainWallCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "Combustible": { + "description": "Indication whether the object is made from combustible material (TRUE) or not (FALSE)." + }, + "FireRating": { + "description": "Fire rating given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SurfaceSpreadOfFlame": { + "description": "Indication on how the flames spread around the surface, It is given according to the national building code that governs the fire behaviour for materials." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Here the total thermal transmittance coefficient through the wall (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_curtainwallcommon.htm" + }, + "Pset_DamperOccurrence": { + "properties": { + "SizingMethod": { + "description": "Identifies whether the damper is sized nominally or with exact measurements:" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_damperoccurrence.htm" + }, + "Pset_DamperPHistory": { + "properties": { + "AirFlowRate": { + "description": "Air flow rate." + }, + "BladePositionAngle": { + "description": "Blade position angle; angle between the blade and flow direction ( 0 - 90)." + }, + "DamperPosition": { + "description": "Damper position (0-1); damper position ( 0=closed=90deg position angle, 1=open=0deg position angle." + }, + "Leakage": { + "description": "Air leakage rate." + }, + "PressureDrop": { + "description": "Pressure drop." + }, + "PressureLossCoefficient": { + "description": "Pressure loss coefficient." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_damperphistory.htm" + }, + "Pset_DamperTypeCommon": { + "properties": { + "BladeAction": { + "description": "Blade action." + }, + "BladeEdge": { + "description": "Blade edge." + }, + "BladeShape": { + "description": "Blade shape. Flat means triple V-groove." + }, + "BladeThickness": { + "description": "The thickness of the damper blade." + }, + "CloseOffRating": { + "description": "Close off rating." + }, + "FaceArea": { + "description": "Face area open to the airstream." + }, + "FrameDepth": { + "description": "The length (or depth) of the damper frame." + }, + "FrameThickness": { + "description": "The thickness of the damper frame material." + }, + "FrameType": { + "description": "The type of frame used by the damper (e.g., Standard, Single Flange, Single Reversed Flange, Double Flange, etc.)." + }, + "LeakageCurve": { + "description": "Leakage versus pressure drop; Leakage = f (pressure)." + }, + "LeakageFullyClosed": { + "description": "Leakage when fully closed." + }, + "LossCoefficentCurve": { + "description": "Loss coefficient \u2013 blade position angle curve; ratio of pressure drop to velocity pressure versus blade angle; C = f (blade angle position)." + }, + "MaximumAirFlowRate": { + "description": "Maximum allowable air flow rate." + }, + "MaximumWorkingPressure": { + "description": "Maximum working pressure." + }, + "NominalAirFlowRate": { + "description": "Nominal air flow rate." + }, + "NumberofBlades": { + "description": "Number of blades." + }, + "OpenPressureDrop": { + "description": "Total pressure drop across damper." + }, + "Operation": { + "description": "The operational mechanism for the damper operation." + }, + "Orientation": { + "description": "The intended orientation for the damper as specified by the manufacturer." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "RegeneratedSoundCurve": { + "description": "Regenerated sound versus air flow rate." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Temperature range." + }, + "TemperatureRating": { + "description": "Temperature rating." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_dampertypecommon.htm" + }, + "Pset_DamperTypeControlDamper": { + "properties": { + "ControlDamperOperation": { + "description": "The inherent characteristic of the control damper operation." + }, + "TorqueRange": { + "description": "Torque range: minimum operational torque to maximum allowable torque." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_dampertypecontroldamper.htm" + }, + "Pset_DamperTypeFireDamper": { + "properties": { + "ActuationType": { + "description": "Enumeration that identifies the different types of dampers." + }, + "ClosureRatingEnum": { + "description": "Enumeration that identifies the closure rating for the damper." + }, + "FireResistanceRating": { + "description": "Measure of the fire resistance rating in hours (e.g., 1.5 hours, 2 hours, etc.)." + }, + "FusibleLinkTemperature": { + "description": "The temperature that the fusible link melts." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_dampertypefiredamper.htm" + }, + "Pset_DamperTypeFireSmokeDamper": { + "properties": { + "ActuationType": { + "description": "Enumeration that identifies the different types of dampers." + }, + "ClosureRatingEnum": { + "description": "Enumeration that identifies the closure rating for the damper." + }, + "ControlType": { + "description": "The type of control used to operate the damper (e.g., Open/Closed Indicator, Resetable Temperature Sensor, Temperature Override, etc.)." + }, + "FireResistanceRating": { + "description": "Measure of the fire resistance rating in hours (e.g., 1.5 hours, 2 hours, etc.)." + }, + "FusibleLinkTemperature": { + "description": "The temperature that the fusible link melts." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_dampertypefiresmokedamper.htm" + }, + "Pset_DamperTypeSmokeDamper": { + "properties": { + "ControlType": { + "description": "The type of control used to operate the damper (e.g., Open/Closed Indicator, Resetable Temperature Sensor, Temperature Override, etc.) ." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_dampertypesmokedamper.htm" + }, + "Pset_DiscreteAccessoryColumnShoe": { + "properties": { + "ColumnShoeBasePlateDepth": { + "description": "The depth of the column shoe base plate." + }, + "ColumnShoeBasePlateThickness": { + "description": "The thickness of the column shoe base plate." + }, + "ColumnShoeBasePlateWidth": { + "description": "The width of the column shoe base plate." + }, + "ColumnShoeCasingDepth": { + "description": "The depth of the column shoe casing." + }, + "ColumnShoeCasingHeight": { + "description": "The height of the column shoe casing." + }, + "ColumnShoeCasingWidth": { + "description": "The width of the column shoe casing." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessorycolumnshoe.htm" + }, + "Pset_DiscreteAccessoryCornerFixingPlate": { + "properties": { + "CornerFixingPlateFlangeWidthInPlaneX": { + "description": "The flange width of the L-shaped corner plate in plane X." + }, + "CornerFixingPlateFlangeWidthInPlaneZ": { + "description": "The flange width of the L-shaped corner plate in plane Z." + }, + "CornerFixingPlateLength": { + "description": "The length of the L-shaped corner plate." + }, + "CornerFixingPlateThickness": { + "description": "The thickness of the L-shaped corner plate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessorycornerfixingplate.htm" + }, + "Pset_DiscreteAccessoryDiagonalTrussConnector": { + "properties": { + "DiagonalTrussBaseBarDiameter": { + "description": "The nominal diameter of the base bar." + }, + "DiagonalTrussCrossBarDiameter": { + "description": "The nominal diameter of the diagonal cross-bars." + }, + "DiagonalTrussCrossBarSpacing": { + "description": "The spacing between diagonal cross-bar sections." + }, + "DiagonalTrussHeight": { + "description": "The overall height of the truss connector." + }, + "DiagonalTrussLength": { + "description": "The overall length of the truss connector." + }, + "DiagonalTrussSecondaryBarDiameter": { + "description": "The nominal diameter of the secondary bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessorydiagonaltrussconnector.htm" + }, + "Pset_DiscreteAccessoryEdgeFixingPlate": { + "properties": { + "EdgeFixingPlateFlangeWidthInPlaneX": { + "description": "The flange width of the L-shaped edge plate in plane X." + }, + "EdgeFixingPlateFlangeWidthInPlaneZ": { + "description": "The flange width of the L-shaped edge plate in plane Z." + }, + "EdgeFixingPlateLength": { + "description": "The length of the L-shaped edge plate." + }, + "EdgeFixingPlateThickness": { + "description": "The thickness of the L-shaped edge plate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessoryedgefixingplate.htm" + }, + "Pset_DiscreteAccessoryFixingSocket": { + "properties": { + "FixingSocketHeight": { + "description": "The overall height of the fixing socket." + }, + "FixingSocketThreadDiameter": { + "description": "The nominal diameter of the thread." + }, + "FixingSocketThreadLength": { + "description": "The length of the threaded part of the fixing socket." + }, + "FixingSocketTypeReference": { + "description": "Type reference for the fixing socket according to local standards." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessoryfixingsocket.htm" + }, + "Pset_DiscreteAccessoryLadderTrussConnector": { + "properties": { + "LadderTrussBaseBarDiameter": { + "description": "The nominal diameter of the base bar." + }, + "LadderTrussCrossBarDiameter": { + "description": "The nominal diameter of the straight cross-bars." + }, + "LadderTrussCrossBarSpacing": { + "description": "The spacing between the straight cross-bars." + }, + "LadderTrussHeight": { + "description": "The overall height of the truss connector." + }, + "LadderTrussLength": { + "description": "The overall length of the truss connector." + }, + "LadderTrussSecondaryBarDiameter": { + "description": "The nominal diameter of the secondary bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessoryladdertrussconnector.htm" + }, + "Pset_DiscreteAccessoryStandardFixingPlate": { + "properties": { + "StandardFixingPlateDepth": { + "description": "The depth of the standard fixing plate." + }, + "StandardFixingPlateThickness": { + "description": "The thickness of the standard fixing plate." + }, + "StandardFixingPlateWidth": { + "description": "The width of the standard fixing plate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessorystandardfixingplate.htm" + }, + "Pset_DiscreteAccessoryWireLoop": { + "properties": { + "WireDiameter": { + "description": "The nominal diameter of the wire." + }, + "WireEmbeddingLength": { + "description": "The length of the part of wire which is embedded in the precast concrete element." + }, + "WireLoopBasePlateLength": { + "description": "The length of the base plate." + }, + "WireLoopBasePlateThickness": { + "description": "The thickness of the base plate." + }, + "WireLoopBasePlateWidth": { + "description": "The width of the base plate." + }, + "WireLoopLength": { + "description": "The length of the fastening loop part of the wire." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_discreteaccessorywireloop.htm" + }, + "Pset_DistributionChamberElementCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specific instance (e.g. 'WWS/VS1/400/001', which indicates the occurrence belongs to system WWS, subsystems VSI/400, and has the component number 001)." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementcommon.htm" + }, + "Pset_DistributionChamberElementTypeFormedDuct": { + "properties": { + "AccessCoverLoadRating": { + "description": "The load rating of the access cover (which may be a value or an alphanumerically defined class rating)." + }, + "BaseThickness": { + "description": "The thickness of the duct base construction NOTE: It is assumed that duct base will be constructed at a single thickness." + }, + "ClearDepth": { + "description": "The depth of the formed space in the duct." + }, + "ClearWidth": { + "description": "The width of the formed space in the duct." + }, + "WallThickness": { + "description": "The thickness of the duct wall construction NOTE: It is assumed that chamber walls will be constructed at a single thickness." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypeformedduct.htm" + }, + "Pset_DistributionChamberElementTypeInspectionChamber": { + "properties": { + "AccessCoverLoadRating": { + "description": "The load rating of the access cover (which may be a value or an alphanumerically defined class rating)." + }, + "AccessCoverMaterial": { + "description": "The material from which the access cover to the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "AccessLengthOrRadius": { + "description": "The length of the chamber access cover or, where the plan shape of the cover is circular, the radius." + }, + "AccessWidth": { + "description": "The width of the chamber access cover where the plan shape of the cover is not circular." + }, + "BaseMaterial": { + "description": "The material from which the base of the chamber is constructed. NOTE: It is assumed that chamber base will be constructed of a single material." + }, + "BaseThickness": { + "description": "The thickness of the chamber base construction NOTE: It is assumed that chamber base will be constructed at a single thickness." + }, + "ChamberLengthOrRadius": { + "description": "Length or, in the event of the shape being circular in plan, the radius of the chamber." + }, + "ChamberWidth": { + "description": "Width, in the event of the shape being non circular in plan." + }, + "InvertLevel": { + "description": "Level of the lowest part of the cross section as measured from ground level." + }, + "SoffitLevel": { + "description": "Level of the highest internal part of the cross section as measured from ground level." + }, + "WallMaterial": { + "description": "The material from which the wall of the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "WallThickness": { + "description": "The thickness of the chamber wall construction NOTE: It is assumed that chamber walls will be constructed at a single thickness." + }, + "WithBackdrop": { + "description": "Indicates whether the chamber has a backdrop or tumbling bay (TRUE) or not (FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypeinspectionchamber.htm" + }, + "Pset_DistributionChamberElementTypeInspectionPit": { + "properties": { + "Depth": { + "description": "The depth of the pit." + }, + "Length": { + "description": "The length of the pit." + }, + "Width": { + "description": "The width of the pit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypeinspectionpit.htm" + }, + "Pset_DistributionChamberElementTypeManhole": { + "properties": { + "AccessCoverLoadRating": { + "description": "The load rating of the access cover (which may be a value or an alphanumerically defined class rating)." + }, + "AccessCoverMaterial": { + "description": "The material from which the access cover to the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "AccessLengthOrRadius": { + "description": "The length of the chamber access cover or, where the plan shape of the cover is circular, the radius." + }, + "AccessWidth": { + "description": "The width of the chamber access cover where the plan shape of the cover is not circular." + }, + "BaseMaterial": { + "description": "The material from which the base of the chamber is constructed. NOTE: It is assumed that chamber base will be constructed of a single material." + }, + "BaseThickness": { + "description": "The thickness of the chamber base construction NOTE: It is assumed that chamber base will be constructed at a single thickness." + }, + "HasSteps": { + "description": "Indicates whether the chamber has steps (TRUE) or not (FALSE)." + }, + "InvertLevel": { + "description": "Level of the lowest part of the cross section as measured from ground level." + }, + "IsShallow": { + "description": "Indicates whether the chamber has been designed as being shallow (TRUE) or deep (FALSE)." + }, + "SoffitLevel": { + "description": "Level of the highest internal part of the cross section as measured from ground level." + }, + "WallMaterial": { + "description": "The material from which the wall of the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "WallThickness": { + "description": "The thickness of the chamber wall construction NOTE: It is assumed that chamber walls will be constructed at a single thickness." + }, + "WithBackdrop": { + "description": "Indicates whether the chamber has a backdrop or tumbling bay (TRUE) or not (FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypemanhole.htm" + }, + "Pset_DistributionChamberElementTypeMeterChamber": { + "properties": { + "AccessCoverMaterial": { + "description": "The material from which the access cover to the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "BaseMaterial": { + "description": "The material from which the base of the chamber is constructed. NOTE: It is assumed that chamber base will be constructed of a single material." + }, + "BaseThickness": { + "description": "The thickness of the chamber base construction. NOTE: It is assumed that chamber base will be constructed at a single thickness." + }, + "ChamberLengthOrRadius": { + "description": "Length or, in the event of the shape being circular in plan, the radius of the chamber." + }, + "ChamberWidth": { + "description": "Width, in the event of the shape being non circular in plan." + }, + "WallMaterial": { + "description": "The material from which the wall of the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "WallThickness": { + "description": "The thickness of the chamber wall construction . NOTE: It is assumed that chamber walls will be constructed at a single thickness." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypemeterchamber.htm" + }, + "Pset_DistributionChamberElementTypeSump": { + "properties": { + "InvertLevel": { + "description": "The lowest point in the cross section of the sump." + }, + "Length": { + "description": "The length of the sump." + }, + "Width": { + "description": "The width of the sump." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypesump.htm" + }, + "Pset_DistributionChamberElementTypeTrench": { + "properties": { + "Depth": { + "description": "The depth of the trench." + }, + "InvertLevel": { + "description": "Level of the lowest part of the cross section as measured from ground level." + }, + "Width": { + "description": "The width of the trench." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypetrench.htm" + }, + "Pset_DistributionChamberElementTypeValveChamber": { + "properties": { + "AccessCoverMaterial": { + "description": "The material from which the access cover to the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "BaseMaterial": { + "description": "The material from which the base of the chamber is constructed. NOTE: It is assumed that chamber base will be constructed of a single material." + }, + "BaseThickness": { + "description": "The thickness of the chamber base construction. NOTE: It is assumed that chamber base will be constructed at a single thickness." + }, + "ChamberLengthOrRadius": { + "description": "Length or, in the event of the shape being circular in plan, the radius of the chamber." + }, + "ChamberWidth": { + "description": "Width, in the event of the shape being non circular in plan." + }, + "WallMaterial": { + "description": "The material from which the wall of the chamber is constructed. NOTE: It is assumed that chamber walls will be constructed of a single material." + }, + "WallThickness": { + "description": "The thickness of the chamber wall construction. NOTE: It is assumed that chamber walls will be constructed at a single thickness." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionchamberelementtypevalvechamber.htm" + }, + "Pset_DistributionPortCommon": { + "properties": { + "ColorCode": { + "description": "Name of a color for identifying the connector, if applicable." + }, + "PortNumber": { + "description": "The port index for logically ordering the port within the containing element or element type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionportcommon.htm" + }, + "Pset_DistributionPortPHistoryCable": { + "properties": { + "ApparentPower": { + "description": "Apparent power." + }, + "Current": { + "description": "Log of electrical current." + }, + "DataReceived": { + "description": "For data ports, captures log of data received. The LIST at IfcTimeSeriesValue.Values may split out data according to Pset_DistributionPortTypeCable.Protocols." + }, + "DataTransmitted": { + "description": "For data ports, captures log of data transmitted. The LIST at IfcTimeSeriesValue.Values may split out data according to Pset_DistributionPortTypeCable.Protocols." + }, + "PowerFactor": { + "description": "Power factor." + }, + "ReactivePower": { + "description": "Reactive power." + }, + "RealPower": { + "description": "Real power." + }, + "Voltage": { + "description": "Log of electrical voltage." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionportphistorycable.htm" + }, + "Pset_DistributionPortPHistoryDuct": { + "properties": { + "FlowCondition": { + "description": "Defines the flow condition as a percentage of the cross-sectional area." + }, + "MassFlowRate": { + "description": "The mass flow rate of the fluid." + }, + "Pressure": { + "description": "The pressure of the fluid." + }, + "Temperature": { + "description": "Temperature of the fluid. For air this value represents the dry bulb temperature." + }, + "Velocity": { + "description": "The velocity of the fluid." + }, + "VolumetricFlowRate": { + "description": "The volumetric flow rate of the fluid." + }, + "WetBulbTemperature": { + "description": "Wet bulb temperature of the fluid; only applicable if the fluid is air." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionportphistoryduct.htm" + }, + "Pset_DistributionPortPHistoryPipe": { + "properties": { + "Flowrate": { + "description": "The flowrate of the fuel." + }, + "Pressure": { + "description": "The pressure of the fuel." + }, + "Temperature": { + "description": "The temperature of the fuel." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionportphistorypipe.htm" + }, + "Pset_DistributionPortTypeCable": { + "properties": { + "ConductorFunction": { + "description": "For ports distributing power, indicates function of the conductors to which the load is connected." + }, + "ConnectionGender": { + "description": "The physical connection gender." + }, + "ConnectionSubtype": { + "description": "The physical port connection subtype that further qualifies the ConnectionType. The following values are recommended:" + }, + "ConnectionType": { + "description": "The physical port connection:" + }, + "Current": { + "description": "The actual current and operable range." + }, + "CurrentContent3rdHarmonic": { + "description": "The ratio between the third harmonic current and the phase current." + }, + "Power": { + "description": "The actual power and operable range." + }, + "Protocols": { + "description": "For data ports, identifies the protocols used as defined by the Open System Interconnection (OSI) Basic Reference Model (ISO 7498). Layers include: 1. Physical; 2. DataLink; 3. Network; 4. Transport; 5. Session; 6. Presentation; 7. Application. Example: 3:IP, 4:TCP, 5:HTTP" + }, + "Voltage": { + "description": "The actual voltage and operable range." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionporttypecable.htm" + }, + "Pset_DistributionPortTypeDuct": { + "properties": { + "ConnectionSubType": { + "description": "The physical port connection subtype that further qualifies the ConnectionType." + }, + "ConnectionType": { + "description": "The end-style treatment of the duct port:" + }, + "DryBulbTemperature": { + "description": "Dry bulb temperature of the air." + }, + "NominalHeight": { + "description": "The nominal height of the duct connection. Only provided for rectangular shaped ducts." + }, + "NominalThickness": { + "description": "The nominal wall thickness of the duct at the connection point." + }, + "NominalWidth": { + "description": "The nominal width or diameter of the duct connection." + }, + "Pressure": { + "description": "The pressure of the fluid." + }, + "Velocity": { + "description": "The velocity of the fluid." + }, + "VolumetricFlowRate": { + "description": "The volumetric flow rate of the fluid." + }, + "WetBulbTemperature": { + "description": "Wet bulb temperature of the air." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionporttypeduct.htm" + }, + "Pset_DistributionPortTypePipe": { + "properties": { + "ConnectionSubType": { + "description": "The physical port connection subtype that further qualifies the ConnectionType." + }, + "ConnectionType": { + "description": "The end-style treatment of the pipe port:" + }, + "FlowCondition": { + "description": "Defines the flow condition as a percentage of the cross-sectional area." + }, + "InnerDiameter": { + "description": "The actual inner diameter of the pipe." + }, + "MassFlowRate": { + "description": "The mass flow rate of the fluid." + }, + "NominalDiameter": { + "description": "The nominal diameter of the pipe connection." + }, + "OuterDiameter": { + "description": "The actual outer diameter of the pipe." + }, + "Pressure": { + "description": "The pressure of the fluid." + }, + "Temperature": { + "description": "Temperature of the fluid." + }, + "Velocity": { + "description": "The velocity of the fluid." + }, + "VolumetricFlowRate": { + "description": "The volumetric flow rate of the fluid." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionporttypepipe.htm" + }, + "Pset_DistributionSystemCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specific instance of a distribution system, or sub-system (e.g. 'WWS/VS1', which indicates the system to be WWS, subsystems VSI/400). The reference values depend on the local code of practice." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionsystemcommon.htm" + }, + "Pset_DistributionSystemTypeElectrical": { + "properties": { + "Diversity": { + "description": "The ratio, expressed as a numerical value or as a percentage, of the simultaneous maximum demand of a group of electrical appliances or consumers within a specified period, to the sum of their individual maximum demands within the same period. The group of electrical appliances is in this case connected to this circuit. Defenition from IEC 60050, IEV 691-10-04 NOTE1: It is often not desirable to size each conductor in a distribution system to support the total connected load at that point in the network. Diversity is applied on the basis of the anticipated loadings that are likely to result from all loads not being connected at the same time. NOTE2: Diversity is applied to final circuits only, not to sub-main circuits supplying other DBs." + }, + "ElectricalSystemCategory": { + "description": "Designates the voltage range of the circuit, according to IEC. HIGHVOLTAGE indicates >1000V AC or >1500V DV; LOWVOLTAGE indicates 50-1000V AC or 120-1500V DC; EXTRALOWVOLTAGE indicates <50V AC or <120V DC." + }, + "ElectricalSystemType": { + "description": "For certain purposes of electrical regulations, IEC 60364 defines types of system using type identifiers. Assignment of identifiers depends upon the relationship of the source, and of exposed conductive parts of the installation, to Ground (Earth). Identifiers that may be assigned through IEC 60364 are: " + }, + "MaximumAllowedVoltageDrop": { + "description": "The maximum voltage drop across the circuit that must not be exceeded. There are two voltage drop limit settings that may be applied; one for sub-main circuits, and one in each Distribution Board or Consumer Unit for final circuits connected to that board. The settings should limit the overall voltage drop to the required level. Default settings of 1.5% for sub-main circuits and 2.5% for final circuits, giving an overall limit of 4% may be applied. NOTE: This value may also be specified as a constraint within an IFC model if required but is included within the property set at this stage pending implementation of the required capabilities within software applications." + }, + "NetImpedance": { + "description": "The maximum earth loop impedance upstream of a circuit (typically stated as the variable Zs). This value is for 55o C (130oF) Celsius usage." + }, + "NumberOfLiveConductors": { + "description": "Number of live conductors within this circuit. Either this property or the ConductorFunction property (if only one) may be asserted." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionsystemtypeelectrical.htm" + }, + "Pset_DistributionSystemTypeVentilation": { + "properties": { + "AspectRatio": { + "description": "The default aspect ratio." + }, + "DesignName": { + "description": "A name for the design values." + }, + "DuctSealant": { + "description": "Type of sealant used on the duct and fittings." + }, + "DuctSizingMethod": { + "description": "Enumeration that identifies the methodology to be used to size system components." + }, + "FrictionLoss": { + "description": "The pressure loss due to friction per unit length. (Data type = PressureMeasure/LengthMeasure)" + }, + "LeakageClass": { + "description": "Nominal leakage rating for the system components." + }, + "MaximumVelocity": { + "description": "The maximum design velocity of the air in the duct or fitting." + }, + "MinimumHeight": { + "description": "The minimum duct height for rectangular, oval or round duct." + }, + "MinimumWidth": { + "description": "The minimum duct width for oval or rectangular duct." + }, + "PressureClass": { + "description": "Nominal pressure rating of the system components. (Data type = PressureMeasure)" + }, + "ScrapFactor": { + "description": "Sheet metal scrap factor." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_distributionsystemtypeventilation.htm" + }, + "Pset_DoorCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "DurabilityRating": { + "description": "Durability against mechanical stress. It is given according to the national code or regulation." + }, + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here it defines an exit door in accordance to the national building code." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety code or regulation." + }, + "GlazingAreaFraction": { + "description": "Fraction of the glazing area relative to the total area of the filling element. It shall be used, if the glazing area is not given separately for all panels within the filling element." + }, + "HandicapAccessible": { + "description": "Indication that this object is designed to be accessible by the handicapped. It is giving according to the requirements of the national building code." + }, + "HasDrive": { + "description": "Indication whether this object has an automatic drive to operate it (TRUE) or no drive (FALSE)" + }, + "HygrothermalRating": { + "description": "Resistence against hygrothermal impact from different temperatures and humidities inside and outside. It is given according to the national code or regulation." + }, + "Infiltration": { + "description": "Infiltration flowrate of outside air for the filler object based on the area of the filler object at a pressure level of 50 Pascals. It shall be used, if the length of all joints is unknown." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "MechanicalLoadRating": { + "description": "Mechanical load rating for this object. It is provided according to the national building code." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "SecurityRating": { + "description": "Index based rating system indicating security level. It is giving according to the national building code." + }, + "SelfClosing": { + "description": "Indication whether this object is designed to close automatically after use (TRUE) or not (FALSE)." + }, + "SmokeStop": { + "description": "Indication whether the object is designed to provide a smoke stop (TRUE) or not (FALSE)." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. It applies to the total door construction." + }, + "WaterTightnessRating": { + "description": "Water tightness rating for this object. It is provided according to the national building code." + }, + "WindLoadRating": { + "description": "Wind load resistance rating for this object. It is provided according to the national building code." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_doorcommon.htm" + }, + "Pset_DoorWindowGlazingType": { + "properties": { + "FillGas": { + "description": "Name of the gas by which the gap between two glass layers is filled. It is given for information purposes only." + }, + "GlassColor": { + "description": "Color (tint) selection for this glazing. It is given for information purposes only." + }, + "GlassLayers": { + "description": "Number of glass layers within the frame. E.g. \"2\" for double glazing." + }, + "GlassThickness1": { + "description": "Thickness of the first (inner) glass layer." + }, + "GlassThickness2": { + "description": "Thickness of the second (intermediate or outer) glass layer." + }, + "GlassThickness3": { + "description": "Thickness of the third (outer) glass layer." + }, + "IsCoated": { + "description": "Indication whether the glass is coated with a material (TRUE) or not (FALSE)." + }, + "IsLaminated": { + "description": "Indication whether the glass is layered with other materials (TRUE) or not (FALSE)." + }, + "IsTempered": { + "description": "Indication whether the glass is tempered (TRUE) or not (FALSE) ." + }, + "IsWired": { + "description": "Indication whether the glass includes a contained wire mesh to prevent break-in (TRUE) or not (FALSE)" + }, + "ShadingCoefficient": { + "description": "(SC): The measure of the ability of a glazing to transmit solar heat, relative to that ability for 3 mm (1/8-inch) clear, double-strength, single glass. Shading coefficient is being phased out in favor of the solar heat gain coefficient (SHGC), and is approximately equal to the SHGC multiplied by 1.15. The shading coefficient is expressed as a number without units between 0 and 1." + }, + "SolarAbsorption": { + "description": "(Asol) The ratio of incident solar radiation that is absorbed by a glazing system. It is the sum of the absorption distributed to the exterior (a) and to the interior (qi). Note the following equation Asol + Rsol + Tsol = 1" + }, + "SolarHeatGainTransmittance": { + "description": "(SHGC): The ratio of incident solar radiation that contributes to the heat gain of the interior, it is the solar radiation that directly passes (Tsol or \u03c4e) plus the part of the absorbed radiation that is distributed to the interior (qi). The SHGC is refered to also as g-value (g = \u03c4e + qi)." + }, + "SolarReflectance": { + "description": "(Rsol): The ratio of incident solar radiation that is reflected by a glazing system (also named \u03c1e). Note the following equation Asol + Rsol + Tsol = 1" + }, + "SolarTransmittance": { + "description": "(Tsol): The ratio of incident solar radiation that directly passes through a glazing system (also named \u03c4e). Note the following equation Asol + Rsol + Tsol = 1" + }, + "ThermalTransmittanceSummer": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Summer thermal transmittance coefficient of the glazing only, often referred to as (U-value)." + }, + "ThermalTransmittanceWinter": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Winter thermal transmittance coefficient of the glazing only, often referred to as (U-value)." + }, + "VisibleLightReflectance": { + "description": "Fraction of the visible light that is reflected by the glazing at normal incidence. It is a value without unit." + }, + "VisibleLightTransmittance": { + "description": "Fraction of the visible light that passes the glazing at normal incidence. It is a value without unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_doorwindowglazingtype.htm" + }, + "Pset_DuctFittingOccurrence": { + "properties": { + "Color": { + "description": "The color of the duct segment." + }, + "HasLiner": { + "description": "TRUE if the fitting has interior duct insulating lining, FALSE if it does not." + }, + "InteriorRoughnessCoefficient": { + "description": "The interior roughness of the duct fitting material." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductfittingoccurrence.htm" + }, + "Pset_DuctFittingPHistory": { + "properties": { + "AirFlowLeakage": { + "description": "Volumetric leakage flow rate." + }, + "AtmosphericPressure": { + "description": "Ambient atmospheric pressure." + }, + "LossCoefficient": { + "description": "Dimensionless loss coefficient used for calculating fluid resistance representing the ratio of total pressure loss to velocity pressure at a referenced cross-section." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductfittingphistory.htm" + }, + "Pset_DuctFittingTypeCommon": { + "properties": { + "PressureClass": { + "description": "Pressure classification as defined by the authority having jurisdiction (e.g., SMACNA, etc.)." + }, + "PressureRange": { + "description": "Allowable maximum and minimum working pressure (relative to ambient pressure)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable maximum and minimum temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductfittingtypecommon.htm" + }, + "Pset_DuctSegmentOccurrence": { + "properties": { + "Color": { + "description": "The color of the duct segment." + }, + "HasLiner": { + "description": "TRUE if the fitting has interior duct insulating lining, FALSE if it does not." + }, + "InteriorRoughnessCoefficient": { + "description": "The interior roughness of the duct fitting material." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductsegmentoccurrence.htm" + }, + "Pset_DuctSegmentPHistory": { + "properties": { + "AtmosphericPressure": { + "description": "Ambient atmospheric pressure." + }, + "FluidFlowLeakage": { + "description": "Volumetric leakage flow rate." + }, + "LeakageCurve": { + "description": "Leakage per unit length curve versus working pressure. If a scalar is expressed then it represents LeakageClass which is flowrate per unit area at a specified pressure rating (e.g., ASHRAE Fundamentals 2001 34.16.)." + }, + "LossCoefficient": { + "description": "Dimensionless loss coefficient used for calculating fluid resistance representing the ratio of total pressure loss to velocity pressure at a referenced cross-section." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductsegmentphistory.htm" + }, + "Pset_DuctSegmentTypeCommon": { + "properties": { + "LongitudinalSeam": { + "description": "The type of seam to be used along the longitudinal axis of the duct segment." + }, + "NominalDiameterOrWidth": { + "description": "The nominal diameter or width of the duct segment." + }, + "NominalHeight": { + "description": "The nominal height of the duct segment." + }, + "PressureRange": { + "description": "Allowable maximum and minimum working pressure (relative to ambient pressure)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Reinforcement": { + "description": "The type of reinforcement, if any, used for the duct segment." + }, + "ReinforcementSpacing": { + "description": "The spacing between reinforcing elements." + }, + "Shape": { + "description": "Cross sectional shape. Note that this shape is uniform throughout the length of the segment. For nonuniform shapes, a transition fitting should be used instead." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable maximum and minimum temperature." + }, + "WorkingPressure": { + "description": "Pressure classification as defined by the authority having jurisdiction (e.g., SMACNA, etc.)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductsegmenttypecommon.htm" + }, + "Pset_DuctSilencerPHistory": { + "properties": { + "AirFlowRate": { + "description": "Volumetric air flow rate." + }, + "AirPressureDropCurve": { + "description": "Air pressure drop as a function of air flow rate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductsilencerphistory.htm" + }, + "Pset_DuctSilencerTypeCommon": { + "properties": { + "AirFlowrateRange": { + "description": "Possible range of airflow that can be delivered." + }, + "HasExteriorInsulation": { + "description": "TRUE if the silencer has exterior insulation. FALSE if it does not." + }, + "HydraulicDiameter": { + "description": "Hydraulic diameter." + }, + "Length": { + "description": "The finished length of the silencer." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable minimum and maximum temperature." + }, + "Weight": { + "description": "The weight of the silencer." + }, + "WorkingPressureRange": { + "description": "Allowable minimum and maximum working pressure (relative to ambient pressure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_ductsilencertypecommon.htm" + }, + "Pset_ElectricAppliancePHistory": { + "properties": { + "PowerState": { + "description": "Indicates the power state of the device where True is on and False is off." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricappliancephistory.htm" + }, + "Pset_ElectricApplianceTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricappliancetypecommon.htm" + }, + "Pset_ElectricApplianceTypeDishwasher": { + "properties": { + "DishwasherType": { + "description": "Type of dishwasher." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricappliancetypedishwasher.htm" + }, + "Pset_ElectricApplianceTypeElectricCooker": { + "properties": { + "ElectricCookerType": { + "description": "Type of electric cooker." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricappliancetypeelectriccooker.htm" + }, + "Pset_ElectricDistributionBoardOccurrence": { + "properties": { + "IsMain": { + "description": "Identifies if the current instance is a main distribution point or topmost level in an electrical distribution hierarchy (= TRUE) or a sub-main distribution point (= FALSE)." + }, + "IsSkilledOperator": { + "description": "Identifies if the current instance requires a skilled person or instructed person to perform operations on the distribution board (= TRUE) or whether operations may be performed by a person without appropriate skills or instruction (= FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricdistributionboardoccurrence.htm" + }, + "Pset_ElectricDistributionBoardTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricdistributionboardtypecommon.htm" + }, + "Pset_ElectricFlowStorageDevicePHistory": { + "properties": { + "Level": { + "description": "The fraction of usable energy stored." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricflowstoragedevicephistory.htm" + }, + "Pset_ElectricFlowStorageDeviceTypeCommon": { + "properties": { + "ConnectedConductorFunction": { + "description": "Function of the conductors to which the load is connected." + }, + "EarthFault1PoleMaximumState": { + "description": "Maximum 1 pole earth fault current provided at the point of supply i.e. the fault between 1 phase and PE/PEN." + }, + "EarthFault1PoleMinimumState": { + "description": "Minimum 1 pole earth fault current provided at the point of supply i.e. the fault between 1 phase and PE/PEN." + }, + "EarthFault1PolePowerFactorMaximumState": { + "description": "Power factor of the maximum 1 pole earth fault current provided at the point of supply i.e. the fault between 1 phase and PE/PEN." + }, + "EarthFault1PolePowerFactorMinimumState": { + "description": "Power factor of the minimum 1 pole earth fault current provided at the point of supply i.e. the fault between 1 phase and PE/PEN." + }, + "ModuleCapacity": { + "description": "The capacity for each battery module." + }, + "ModulesInParallel": { + "description": "The number of modules in parallel, where the total number of modules equals the number in parallel multiplied by the number in series." + }, + "ModulesInSeries": { + "description": "The number of modules in series, where the total number of modules equals the number in parallel multiplied by the number in series." + }, + "NominalFrequency": { + "description": "The nominal frequency of the supply." + }, + "NominalSupplyVoltage": { + "description": "The nominal voltage of the supply." + }, + "NominalSupplyVoltageOffset": { + "description": "The maximum and minimum allowed voltage of the supply e.g. boundaries of 380V/440V may be applied for a nominal voltage of 400V." + }, + "RadiativeFraction": { + "description": "The fraction of energy converted to heat." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "ShortCircuit1PoleMaximumState": { + "description": "Maximum 1 pole short circuit current provided at the point of supply i.e. the fault between 1 phase and N." + }, + "ShortCircuit1PoleMinimumState": { + "description": "Minimum 1 pole short circuit current provided at the point of supply i.e. the fault between 1 phase and N." + }, + "ShortCircuit1PolePowerFactorMaximumState": { + "description": "Power factor of the maximum 1 pole short circuit current provided at the point of supply i.e. the fault between 1 phase and N." + }, + "ShortCircuit1PolePowerFactorMinimumState": { + "description": "Power factor of the minimum 1 pole short circuit current provided at the point of supply i.e. the fault between 1 phase and N." + }, + "ShortCircuit2PoleMinimumState": { + "description": "Minimum 2 pole short circuit current provided at the point of supply." + }, + "ShortCircuit2PolePowerFactorMinimumState": { + "description": "Power factor of the minimum 2 pole short circuit current provided at the point of supply." + }, + "ShortCircuit3PoleMaximumState": { + "description": "Maximum 3 pole short circuit current provided at the point of supply." + }, + "ShortCircuit3PolePowerFactorMaximumState": { + "description": "Power factor of the maximum 3 pole short circuit current provided at the point of supply." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricflowstoragedevicetypecommon.htm" + }, + "Pset_ElectricGeneratorTypeCommon": { + "properties": { + "ElectricGeneratorEfficiency": { + "description": "The ratio of output capacity to intake capacity." + }, + "MaximumPowerOutput": { + "description": "The maximum output power rating of the engine." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "StartCurrentFactor": { + "description": "IEC. Start current factor defines how large the peek starting current will become on the engine. StartCurrentFactor is multiplied to NominalCurrent and we get the start current." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricgeneratortypecommon.htm" + }, + "Pset_ElectricMotorTypeCommon": { + "properties": { + "ElectricMotorEfficiency": { + "description": "The ratio of output capacity to intake capacity." + }, + "FrameSize": { + "description": "Designation of the frame size according to the named range of frame sizes designated at the place of use or according to a given standard." + }, + "HasPartWinding": { + "description": "Indication of whether the motor is single speed, i.e. has a single winding (= FALSE) or multi-speed i.e.has part winding (= TRUE) ." + }, + "IsGuarded": { + "description": "Indication of whether the motor enclosure is guarded (= TRUE) or not (= FALSE)." + }, + "LockedRotorCurrent": { + "description": "Input current when a motor armature is energized but not rotating." + }, + "MaximumPowerOutput": { + "description": "The maximum output power rating of the engine." + }, + "MotorEnclosureType": { + "description": "A list of the available types of motor enclosure from which that required may be selected." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "StartCurrentFactor": { + "description": "IEC. Start current factor defines how large the peak starting current will become on the engine. StartCurrentFactor is multiplied to NominalCurrent and to give the start current." + }, + "StartingTime": { + "description": "The time (in s) needed for the motor to reach its rated speed with its driven equipment attached, starting from standstill and at the nominal voltage applied at its terminals." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TeTime": { + "description": "The maximum time (in s) at which the motor could run with locked rotor when the motor is used in an EX-environment. The time indicates that a protective device should trip before this time when the starting current of the motor is slowing through the device." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricmotortypecommon.htm" + }, + "Pset_ElectricTimeControlTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electrictimecontroltypecommon.htm" + }, + "Pset_ElectricalDeviceCommon": { + "properties": { + "ConductorFunction": { + "description": "Function of a line conductor to which a device is intended to be connected where L1, L2 and L3 represent the phase lines according to IEC 60446 notation (sometimes phase lines may be referenced by color [Red, Blue, Yellow] or by number [1, 2, 3] etc). Protective Earth is sometimes also known as CPC or common protective conductor. Note that for an electrical device, a set of line conductor functions may be applied." + }, + "HasProtectiveEarth": { + "description": "Indicates whether the electrical device has a protective earth connection (=TRUE) or not (= FALSE)." + }, + "IK_Code": { + "description": "IK Code according to IEC 62262 (2002) is a numeric classification for the degree of protection provided by enclosures for electrical equipment against external mechanical impacts." + }, + "IP_Code": { + "description": "IP Code, the International Protection Marking, IEC 60529), classifies and rates the degree of protection provided against intrusion." + }, + "InsulationStandardClass": { + "description": "Insulation standard classes provides basic protection information against electric shock. Defines levels of insulation required in terms of constructional requirements (creepage and clearance distances) and electrical requirements (compliance with electric strength tests). Basic insulation is considered to be shorted under single fault conditions. The actual values required depend on the working voltage to which the insulation is subjected, as well as other factors. Also indicates whether the electrical device has a protective earth connection." + }, + "NominalFrequencyRange": { + "description": "The upper and lower limits of frequency for which the operation of the device is certified." + }, + "NumberOfPoles": { + "description": "The number of live lines that is intended to be handled by the device." + }, + "PowerFactor": { + "description": "The ratio between the rated electrical power and the product of the rated current and rated voltage" + }, + "RatedCurrent": { + "description": "The current that a device is designed to handle." + }, + "RatedVoltage": { + "description": "The voltage that a device is designed to handle." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_electricaldevicecommon.htm" + }, + "Pset_ElementAssemblyCommon": { + "properties": { + "Reference": {}, + "Status": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_elementassemblycommon.htm" + }, + "Pset_ElementCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + } + }, + "Pset_ElementComponentCommon": { + "properties": { + "CorrosionTreatment": { + "description": "Determines corrosion treatment for metal components. This property is provided if the requirement needs to be expressed (a) independently of a material specification and (b) as a mere requirements statement rather than a workshop design/ processing feature." + }, + "DeliveryType": { + "description": "Determines how the accessory will be delivered to the site." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_elementcomponentcommon.htm" + }, + "Pset_EngineTypeCommon": { + "properties": { + "EnergySource": { + "description": "The source of energy." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_enginetypecommon.htm" + }, + "Pset_EnvironmentalImpactIndicators": { + "properties": { + "AtmosphericAcidificationPerUnit": { + "description": "Quantity of gases responsible for the atmospheric acidification calculated in equivalent SO2" + }, + "ClimateChangePerUnit": { + "description": "Quantity of greenhouse gases emitted calculated in equivalent CO2" + }, + "EutrophicationPerUnit": { + "description": "Quantity of eutrophicating compounds calculated in equivalent PO4" + }, + "ExpectedServiceLife": { + "description": "Expected service life in years." + }, + "FunctionalUnitReference": { + "description": "Reference to a database or a classification" + }, + "HazardousWastePerUnit": { + "description": "Quantity of hazardous waste generated" + }, + "InertWastePerUnit": { + "description": "Quantity of inert waste generated" + }, + "LifeCyclePhase": { + "description": "The whole life cycle or only a given phase from which environmental data are valid." + }, + "NonHazardousWastePerUnit": { + "description": "Quantity of non hazardous waste generated" + }, + "NonRenewableEnergyConsumptionPerUnit": { + "description": "Quantity of non-renewable energy used as defined in ISO21930:2007" + }, + "PhotochemicalOzoneFormationPerUnit": { + "description": "Quantity of gases creating the photochemical ozone calculated in equivalent ethylene" + }, + "RadioactiveWastePerUnit": { + "description": "Quantity of radioactive waste generated" + }, + "Reference": { + "description": "Reference ID for this specified type in this project" + }, + "RenewableEnergyConsumptionPerUnit": { + "description": "Quantity of renewable energy used as defined in ISO21930:2007" + }, + "ResourceDepletionPerUnit": { + "description": "Quantity of resources used calculated in equivalent antimony" + }, + "StratosphericOzoneLayerDestructionPerUnit": { + "description": "Quantity of gases destroying the stratospheric ozone layer calculated in equivalent CFC-R11" + }, + "TotalPrimaryEnergyConsumptionPerUnit": { + "description": "Quantity of energy used as defined in ISO21930:2007." + }, + "Unit": { + "description": "The unit of the quantity the environmental indicators values are related with." + }, + "WaterConsumptionPerUnit": { + "description": "Quantity of water used." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_environmentalimpactindicators.htm" + }, + "Pset_EnvironmentalImpactValues": { + "properties": { + "AtmosphericAcidification": { + "description": "Quantity of gases responsible for the atmospheric acidification calculated in equivalent SO2." + }, + "ClimateChange": { + "description": "Quantity of greenhouse gases emitted calculated in equivalent CO2." + }, + "Duration": { + "description": "Duration of process." + }, + "Eutrophication": { + "description": "Quantity of eutrophicating compounds calculated in equivalent PO4." + }, + "HazardousWaste": { + "description": "Quantity of hazardous waste generated." + }, + "InertWaste": { + "description": "Quantity of inert waste generated ." + }, + "LeadInTime": { + "description": "Lead in time before start of process." + }, + "LeadOutTime": { + "description": "Lead out time after end of process." + }, + "NonHazardousWaste": { + "description": "Quantity of non hazardous waste generated." + }, + "NonRenewableEnergyConsumption": { + "description": "Quantity of non-renewable energy used as defined in ISO21930:2007" + }, + "PhotochemicalOzoneFormation": { + "description": "Quantity of gases creating the photochemical ozone calculated in equivalent ethylene." + }, + "RadioactiveWaste": { + "description": "Quantity of radioactive waste generated." + }, + "RenewableEnergyConsumption": { + "description": "Quantity of renewable energy used as defined in ISO21930:2007" + }, + "ResourceDepletion": { + "description": "Quantity of resources used calculated in equivalent antimony." + }, + "StratosphericOzoneLayerDestruction": { + "description": "Quantity of gases destroying the stratospheric ozone layer calculated in equivalent CFC-R11." + }, + "TotalPrimaryEnergyConsumption": { + "description": "Quantity of energy used as defined in ISO21930:2007." + }, + "WaterConsumption": { + "description": "Quantity of water used." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_environmentalimpactvalues.htm" + }, + "Pset_EvaporativeCoolerPHistory": { + "properties": { + "Effectiveness": { + "description": "Ratio of the change in dry bulb temperature of the (primary) air stream to the difference between the entering dry bulb temperature of the (primary) air and the wet-bulb temperature of the (secondary) air." + }, + "LatentHeatTransferRate": { + "description": "Latent heat transfer rate to primary air flow." + }, + "SensibleHeatTransferRate": { + "description": "Sensible heat transfer rate to primary air flow." + }, + "TotalHeatTransferRate": { + "description": "Total heat transfer rate to primary air flow." + }, + "WaterSumpTemperature": { + "description": "Water sump temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_evaporativecoolerphistory.htm" + }, + "Pset_EvaporativeCoolerTypeCommon": { + "properties": { + "AirPressureDropCurve": { + "description": "Air pressure drop as function of air flow rate." + }, + "EffectivenessTable": { + "description": "Total heat transfer effectiveness curve as a function of the primary air flow rate." + }, + "FlowArrangement": { + "description": "CounterFlow: Air and water flow enter in different directions." + }, + "HeatExchangeArea": { + "description": "Heat exchange area." + }, + "OperationTemperatureRange": { + "description": "Allowable operation ambient air temperature range." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "WaterPressDropCurve": { + "description": "Water pressure drop as function of water flow rate." + }, + "WaterRequirement": { + "description": "Make-up water requirement." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_evaporativecoolertypecommon.htm" + }, + "Pset_EvaporatorPHistory": { + "properties": { + "CompressorEvaporatorHeatGain": { + "description": "Heat gain between the evaporator outlet and the compressor inlet." + }, + "CompressorEvaporatorPressureDrop": { + "description": "Pressure drop between the evaporator outlet and the compressor inlet." + }, + "EvaporatingTemperature": { + "description": "Refrigerant evaporating temperature." + }, + "EvaporatorMeanVoidFraction": { + "description": "Mean void fraction in evaporator." + }, + "ExteriorHeatTransferCoefficient": { + "description": "Exterior heat transfer coefficient associated with exterior surface area." + }, + "HeatRejectionRate": { + "description": "Sum of the refrigeration effect and the heat equivalent of the power input to the compressor." + }, + "InteriorHeatTransferCoefficient": { + "description": "Interior heat transfer coefficient associated with interior surface area." + }, + "LogarithmicMeanTemperatureDifference": { + "description": "Logarithmic mean temperature difference between refrigerant and water or air." + }, + "RefrigerantFoulingResistance": { + "description": "Fouling resistance on the refrigerant side." + }, + "UAcurves": { + "description": "UV = f (VExterior, VInterior), UV as a function of interior and exterior fluid flow velocity at the entrance." + }, + "WaterFoulingResistance": { + "description": "Fouling resistance on water/air side." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_evaporatorphistory.htm" + }, + "Pset_EvaporatorTypeCommon": { + "properties": { + "EvaporatorCoolant": { + "description": "The fluid used for the coolant in the evaporator." + }, + "EvaporatorMediumType": { + "description": "ColdLiquid: Evaporator is using liquid type of fluid to exchange heat with refrigerant. ColdAir: Evaporator is using air to exchange heat with refrigerant." + }, + "ExternalSurfaceArea": { + "description": "External surface area (both primary and secondary area)." + }, + "InternalRefrigerantVolume": { + "description": "Internal volume of evaporator (refrigerant side)." + }, + "InternalSurfaceArea": { + "description": "Internal surface area." + }, + "InternalWaterVolume": { + "description": "Internal volume of evaporator (water side)." + }, + "NominalHeatTransferArea": { + "description": "Nominal heat transfer surface area associated with nominal overall heat transfer coefficient." + }, + "NominalHeatTransferCoefficient": { + "description": "Nominal overall heat transfer coefficient associated with nominal heat transfer area." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "RefrigerantClass": { + "description": "Refrigerant class used by the compressor. CFC: Chlorofluorocarbons. HCFC: Hydrochlorofluorocarbons. HFC: Hydrofluorocarbons." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_evaporatortypecommon.htm" + }, + "Pset_FanCentrifugal": { + "properties": { + "Arrangement": { + "description": "Defines the fan and motor drive arrangement as defined by AMCA." + }, + "DirectionOfRotation": { + "description": "The direction of the centrifugal fan wheel rotation when viewed from the drive side of the fan." + }, + "DischargePosition": { + "description": "Centrifugal fan discharge position." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_fancentrifugal.htm" + }, + "Pset_FanOccurrence": { + "properties": { + "ApplicationOfFan": { + "description": "The functional application of the fan." + }, + "CoilPosition": { + "description": "Defines the relationship between a fan and a coil." + }, + "DischargeType": { + "description": "Defines the type of connection at the fan discharge." + }, + "FanMountingType": { + "description": "Defines the method of mounting the fan in the building." + }, + "FractionOfMotorHeatToAirStream": { + "description": "Fraction of the motor heat released into the fluid flow." + }, + "ImpellerDiameter": { + "description": "Diameter of fan wheel - used to scale performance of geometrically similar fans." + }, + "MotorPosition": { + "description": "Defines the location of the motor relative to the air stream." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_fanoccurrence.htm" + }, + "Pset_FanPHistory": { + "properties": { + "DischargePressureLoss": { + "description": "Fan discharge pressure loss associated with the discharge arrangement." + }, + "DischargeVelocity": { + "description": "The speed at which air discharges from the fan through the fan housing discharge opening." + }, + "DrivePowerLoss": { + "description": "Fan drive power losses associated with the type of connection between the motor and the fan wheel." + }, + "FanEfficiency": { + "description": "Fan mechanical efficiency." + }, + "FanPowerRate": { + "description": "Fan power consumption." + }, + "FanRotationSpeed": { + "description": "Fan rotation speed." + }, + "OverallEfficiency": { + "description": "Total efficiency of motor and fan." + }, + "ShaftPowerRate": { + "description": "Fan shaft power." + }, + "WheelTipSpeed": { + "description": "Fan blade tip speed, typically defined as the linear speed of the tip of the fan blade furthest from the shaft." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_fanphistory.htm" + }, + "Pset_FanTypeCommon": { + "properties": { + "CapacityControlType": { + "description": "InletVane: Control by adjusting inlet vane. VariableSpeedDrive: Control by variable speed drive. BladePitchAngle: Control by adjusting blade pitch angle. TwoSpeed: Control by switch between high and low speed. DischargeDamper: Control by modulating discharge damper." + }, + "EfficiencyCurve": { + "description": "Fan efficiency =f (flow rate)." + }, + "MotorDriveType": { + "description": "Motor drive type: DIRECTDRIVE: Direct drive. BELTDRIVE: Belt drive. COUPLING: Coupling. OTHER: Other type of motor drive. UNKNOWN: Unknown motor drive type." + }, + "NominalAirFlowRate": { + "description": "Nominal air flow rate." + }, + "NominalPowerRate": { + "description": "Nominal fan power rate." + }, + "NominalRotationSpeed": { + "description": "Nominal fan wheel speed." + }, + "NominalStaticPressure": { + "description": "The static pressure within the air stream that the fan must overcome to insure designed circulation of air." + }, + "NominalTotalPressure": { + "description": "Nominal total pressure rise across the fan." + }, + "OperationTemperatureRange": { + "description": "Allowable operation ambient air temperature range." + }, + "OperationalCriteria": { + "description": "Time of operation at maximum operational ambient air temperature." + }, + "PressureCurve": { + "description": "Pressure rise = f (flow rate)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_fantypecommon.htm" + }, + "Pset_FastenerWeld": { + "properties": { + "Intermittent": { + "description": "If fillet weld, intermittent or not" + }, + "Process": { + "description": "Reference number of the welding process according to ISO 4063, an up to three digits long code" + }, + "ProcessName": { + "description": "Name of the welding process. Alternative to the numeric Process property." + }, + "Staggered": { + "description": "If intermittent weld, staggered or not" + }, + "Surface1": { + "description": "Aspect of weld seam surface, i.e. 'plane', 'curved' or 'hollow'. Combined welds are given by two corresponding symbols analogous to Type1 and Type2." + }, + "Surface2": { + "description": "See Surface1." + }, + "Type1": { + "description": "Type of weld seam according to ISO 2553. Note, combined welds are given by two corresponding symbols in the direction of the normal axis of the coordinate system. For example, an X weld is specified by Type1 = 'V' and Type2 = 'V'." + }, + "Type2": { + "description": "See Type1." + }, + "a": { + "description": "Measure a according to ISO 2553" + }, + "c": { + "description": "Measure c according to ISO 2553" + }, + "d": { + "description": "Measure d according to ISO 2553" + }, + "e": { + "description": "Measure e according to ISO 2553" + }, + "l": { + "description": "Measure l according to ISO 2553" + }, + "n": { + "description": "Count n according to ISO 2553" + }, + "s": { + "description": "Measure s according to ISO 2553" + }, + "z": { + "description": "Measure z according to ISO 2553" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_fastenerweld.htm" + }, + "Pset_FilterPHistory": { + "properties": { + "CountedEfficiency": { + "description": "Filter efficiency based the particle counts concentration before and after filter against particles with certain size distribution." + }, + "ParticleMassHolding": { + "description": "Mass of particle holding in the filter." + }, + "WeightedEfficiency": { + "description": "Filter efficiency based the particle weight concentration before and after filter against particles with certain size distribution." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_filterphistory.htm" + }, + "Pset_FilterTypeAirParticleFilter": { + "properties": { + "AirParticleFilterType": { + "description": "A panel dry type extended surface filter is a dry-type air filter with random fiber mats or blankets in the forms of pockets, V-shaped or radial pleats, and include the following:" + }, + "CountedEfficiencyCurve": { + "description": "Counted efficiency curve as a function of dust holding weight, efficiency = f (dust holding weight)." + }, + "DustHoldingCapacity": { + "description": "Maximum filter dust holding capacity." + }, + "FaceSurfaceArea": { + "description": "Face area of filter frame." + }, + "FrameMaterial": { + "description": "Filter frame material." + }, + "MediaExtendedArea": { + "description": "Total extended media area." + }, + "NominalCountedEfficiency": { + "description": "Nominal filter efficiency based the particle count concentration before and after the filter against particles with a certain size distribution." + }, + "NominalWeightedEfficiency": { + "description": "Nominal filter efficiency based the particle weight concentration before and after the filter against particles with a certain size distribution." + }, + "PressureDropCurve": { + "description": "Under certain dust holding weight, DelPressure = f (fluidflowRate)" + }, + "SeparationType": { + "description": "Air particulate filter media separation type." + }, + "WeightedEfficiencyCurve": { + "description": "Weighted efficiency curve as a function of dust holding weight, efficiency = f (dust holding weight)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_filtertypeairparticlefilter.htm" + }, + "Pset_FilterTypeCommon": { + "properties": { + "FinalResistance": { + "description": "Filter fluid resistance when replacement is required (i.e., Pressure drop at the maximum air flowrate across the filter when the filter needs replacement per ASHRAE Standard 52.1)." + }, + "FlowRateRange": { + "description": "Possible range of fluid flowrate that can be delivered." + }, + "InitialResistance": { + "description": "Initial new filter fluid resistance (i.e., pressure drop at the maximum air flowrate across the filter when the filter is new per ASHRAE Standard 52.1)." + }, + "NominalFilterFaceVelocity": { + "description": "Filter face velocity." + }, + "NominalFlowrate": { + "description": "Nominal fluid flow rate through the filter." + }, + "NominalMediaSurfaceVelocity": { + "description": "Average fluid velocity at the media surface." + }, + "NominalParticleGeometricMeanDiameter": { + "description": "Particle geometric mean diameter associated with nominal efficiency." + }, + "NominalParticleGeometricStandardDeviation": { + "description": "Particle geometric standard deviation associated with nominal efficiency." + }, + "NominalPressureDrop": { + "description": "Total pressure drop across the filter." + }, + "OperationTemperatureRange": { + "description": "Allowable operation ambient fluid temperature range." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "Weight": { + "description": "Weight of filter." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_filtertypecommon.htm" + }, + "Pset_FilterTypeCompressedAirFilter": { + "properties": { + "AutomaticCondensateDischarge": { + "description": "Whether or not the condensing water or oil is discharged automatically from the filter." + }, + "CloggingIndicator": { + "description": "Whether the filter has an indicator to display the degree of clogging of the filter." + }, + "CompressedAirFilterType": { + "description": "ACTIVATEDCARBON: absorbs oil vapor and odor; PARTICLE_FILTER: used to absorb solid particles of medium size; COALESCENSE_FILTER: used to absorb fine solid, oil, and water particles, also called micro filter" + }, + "OperationPressureMax": { + "description": "Maximum pressure under normal operating conditions." + }, + "ParticleAbsorptionCurve": { + "description": "Ratio of particles that are removed by the filter. Each entry describes the ratio of particles absorbed greater than equal to the specified size and less than the next specified size. For example, given for 3 significant particle sizes >= 0,1 micro m, >= 1 micro m, >= 5 micro m" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_filtertypecompressedairfilter.htm" + }, + "Pset_FilterTypeWaterFilter": { + "properties": { + "WaterFilterType": { + "description": "Further qualifies the type of water filter. Filtration removes undissolved matter; Purification removes dissolved matter; Softening replaces dissolved matter." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_filtertypewaterfilter.htm" + }, + "Pset_FireSuppressionTerminalTypeBreechingInlet": { + "properties": { + "BreechingInletType": { + "description": "Defines the type of breeching inlet." + }, + "CouplingType": { + "description": "Defines the type coupling on the inlet of the breeching inlet." + }, + "HasCaps": { + "description": "Does the inlet connection have protective caps." + }, + "InletDiameter": { + "description": "The inlet diameter of the breeching inlet." + }, + "OutletDiameter": { + "description": "The outlet diameter of the breeching inlet." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_firesuppressionterminaltypebreechinginlet.htm" + }, + "Pset_FireSuppressionTerminalTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_firesuppressionterminaltypecommon.htm" + }, + "Pset_FireSuppressionTerminalTypeFireHydrant": { + "properties": { + "BodyColor": { + "description": "Color of the body of the hydrant." + }, + "CapColor": { + "description": "Color of the caps of the hydrant." + }, + "DischargeFlowRate": { + "description": "The volumetric rate of fluid discharge." + }, + "FireHydrantType": { + "description": "Defines the range of hydrant types from which the required type can be selected where." + }, + "FlowClass": { + "description": "Alphanumeric indication of the flow class of a hydrant (may be used in connection with or instead of the FlowRate property)." + }, + "HoseConnectionSize": { + "description": "The size of connections to which a hose may be connected (other than that to be linked to a pumping unit)." + }, + "NumberOfHoseConnections": { + "description": "The number of hose connections on the hydrant (excluding the pumper connection)." + }, + "PressureRating": { + "description": "Maximum pressure that the hydrant is manufactured to withstand." + }, + "PumperConnectionSize": { + "description": "The size of a connection to which a fire hose may be connected that is then linked to a pumping unit." + }, + "WaterIsPotable": { + "description": "Indication of whether the water flow from the hydrant is potable (set TRUE) or non potable (set FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_firesuppressionterminaltypefirehydrant.htm" + }, + "Pset_FireSuppressionTerminalTypeHoseReel": { + "properties": { + "ClassOfService": { + "description": "A classification of usage of the hose reel that may be applied." + }, + "ClassificationAuthority": { + "description": "The name of the authority that applies the classification of service to the hose reel (e.g. NFPA/FEMA)." + }, + "HoseDiameter": { + "description": "Notional diameter (bore) of the hose." + }, + "HoseLength": { + "description": "Notional length of the hose fitted to the hose reel when fully extended." + }, + "HoseNozzleType": { + "description": "Identifies the predefined types of nozzle (in terms of spray pattern) fitted to the end of the hose from which the type required may be set." + }, + "HoseReelMountingType": { + "description": "Identifies the predefined types of hose reel mounting from which the type required may be set." + }, + "HoseReelType": { + "description": "Identifies the predefined types of hose arrangement from which the type required may be set." + }, + "InletConnectionSize": { + "description": "Size of the inlet connection to the hose reel." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_firesuppressionterminaltypehosereel.htm" + }, + "Pset_FireSuppressionTerminalTypeSprinkler": { + "properties": { + "Activation": { + "description": "Identifies the predefined methods of sprinkler activation from which that required may be set." + }, + "ActivationTemperature": { + "description": "The temperature at which the object is designed to activate." + }, + "BulbLiquidColor": { + "description": "The color of the liquid in the bulb for a bulb activated sprinkler. Note that the liquid color varies according to the activation temperature requirement of the sprinkler head. Note also that this property does not need to be asserted for quick response activated sprinklers." + }, + "ConnectionSize": { + "description": "Size of the inlet connection to the sprinkler." + }, + "CoverageArea": { + "description": "The area that the sprinkler is designed to protect." + }, + "DischargeCoefficient": { + "description": "The coefficient of flow at the sprinkler." + }, + "DischargeFlowRate": { + "description": "The volumetric rate of fluid discharge." + }, + "HasDeflector": { + "description": "Indication of whether the sprinkler has a deflector (baffle) fitted to diffuse the discharge on activation (= TRUE) or not (= FALSE)." + }, + "MaximumWorkingPressure": { + "description": "Maximum pressure that the object is manufactured to withstand." + }, + "ResidualFlowingPressure": { + "description": "The residual flowing pressure in the pipeline at which the discharge flow rate is determined." + }, + "Response": { + "description": "Identifies the predefined methods of sprinkler response from which that required may be set." + }, + "SprinklerType": { + "description": "Identifies the predefined types of sprinkler from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_firesuppressionterminaltypesprinkler.htm" + }, + "Pset_FlowInstrumentPHistory": { + "properties": { + "Quality": { + "description": "Indicates the quality of measurement or failure condition, which may be further qualified by the Status. True: measured values are considered reliable; False: measured values are considered not reliable (i.e. a fault has been detected); Unknown: reliability of values is uncertain." + }, + "Status": { + "description": "Indicates an error code or identifier, whose meaning is specific to the particular automation system. Example values include: 'ConfigurationError', 'NotConnected', 'DeviceFailure', 'SensorFailure', 'LastKnown, 'CommunicationsFailure', 'OutOfService'." + }, + "Value": { + "description": "Indicates measured values over time which may be recorded continuously or only when changed beyond a particular deadband." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_flowinstrumentphistory.htm" + }, + "Pset_FlowInstrumentTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_flowinstrumenttypecommon.htm" + }, + "Pset_FlowInstrumentTypePressureGauge": { + "properties": { + "DisplaySize": { + "description": "The physical size of the display. For a dial pressure gauge it will be the diameter of the dial." + }, + "PressureGaugeType": { + "description": "Identifies the means by which pressure is displayed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_flowinstrumenttypepressuregauge.htm" + }, + "Pset_FlowInstrumentTypeThermometer": { + "properties": { + "DisplaySize": { + "description": "The physical size of the display. In the case of a stem thermometer, this will be the length of the stem. For a dial thermometer, it will be the diameter of the dial." + }, + "ThermometerType": { + "description": "Identifies the means by which temperature is displayed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_flowinstrumenttypethermometer.htm" + }, + "Pset_FlowMeterOccurrence": { + "properties": { + "Purpose": { + "description": "Enumeration defining the purpose of the flow meter occurrence." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmeteroccurrence.htm" + }, + "Pset_FlowMeterTypeCommon": { + "properties": { + "ReadOutType": { + "description": "Indication of the form that readout from the meter takes. In the case of a dial read out, this may comprise multiple dials that give a cumulative reading and/or a mechanical odometer." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "RemoteReading": { + "description": "Indicates whether the meter has a connection for remote reading through connection of a communication device (set TRUE) or not (set FALSE)." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmetertypecommon.htm" + }, + "Pset_FlowMeterTypeEnergyMeter": { + "properties": { + "MaximumCurrent": { + "description": "The maximum allowed current that a device is certified to handle." + }, + "MultipleTarriff": { + "description": "Indicates whether meter has built-in support for multiple tarriffs (variable energy cost rates)." + }, + "NominalCurrent": { + "description": "The nominal current that is designed to be measured." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmetertypeenergymeter.htm" + }, + "Pset_FlowMeterTypeGasMeter": { + "properties": { + "ConnectionSize": { + "description": "Defines the size of inlet and outlet pipe connections to the meter." + }, + "GasType": { + "description": "Defines the types of gas that may be specified." + }, + "MaximumFlowRate": { + "description": "Maximum rate of flow which the meter is expected to pass." + }, + "MaximumPressureLoss": { + "description": "Pressure loss expected across the meter under conditions of maximum flow." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmetertypegasmeter.htm" + }, + "Pset_FlowMeterTypeOilMeter": { + "properties": { + "ConnectionSize": { + "description": "Defines the size of inlet and outlet pipe connections to the meter." + }, + "MaximumFlowRate": { + "description": "Maximum rate of flow which the meter is expected to pass." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmetertypeoilmeter.htm" + }, + "Pset_FlowMeterTypeWaterMeter": { + "properties": { + "BackflowPreventerType": { + "description": "Identifies the type of backflow preventer installed to prevent the backflow of contaminated or polluted water from an irrigation/reticulation system to a potable water supply." + }, + "ConnectionSize": { + "description": "Defines the size of inlet and outlet pipe connections to the meter." + }, + "MaximumFlowRate": { + "description": "Maximum rate of flow which the meter is expected to pass." + }, + "MaximumPressureLoss": { + "description": "Pressure loss expected across the meter under conditions of maximum flow." + }, + "Type": { + "description": "Defines the allowed values for selection of the flow meter operation type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_flowmetertypewatermeter.htm" + }, + "Pset_FootingCommon": { + "properties": { + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)" + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_footingcommon.htm" + }, + "Pset_FurnitureTypeChair": { + "properties": { + "HighestSeatingHeight": { + "description": "The value of seating height of high level if the chair height is adjustable." + }, + "LowestSeatingHeight": { + "description": "The value of seating height of low level if the chair height is adjustable." + }, + "SeatingHeight": { + "description": "The value of seating height if the chair height is not adjustable." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_furnituretypechair.htm" + }, + "Pset_FurnitureTypeCommon": { + "properties": { + "IsBuiltIn": { + "description": "Indicates whether the furniture type is intended to be 'built in' i.e. physically attached to a building or facility (= TRUE) or not i.e. Loose and movable (= FALSE)." + }, + "MainColor": { + "description": "The main color of the furniture of this type." + }, + "NominalDepth": { + "description": "The nominal depth of the furniture of this type. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "NominalHeight": { + "description": "The nominal height of the furniture of this type. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "NominalLength": { + "description": "The nominal length of the furniture of this type. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "Reference": {}, + "Status": {}, + "Style": { + "description": "Description of the furniture style." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_furnituretypecommon.htm" + }, + "Pset_FurnitureTypeDesk": { + "properties": { + "WorksurfaceArea": { + "description": "The value of the work surface area of the desk." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_furnituretypedesk.htm" + }, + "Pset_FurnitureTypeFileCabinet": { + "properties": { + "WithLock": { + "description": "Indicates whether the file cabinet is lockable (= TRUE) or not (= FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_furnituretypefilecabinet.htm" + }, + "Pset_FurnitureTypeTable": { + "properties": { + "NumberOfChairs": { + "description": "Maximum number of chairs that can fit with the table for normal use." + }, + "WorksurfaceArea": { + "description": "The value of the work surface area of the desk.." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_furnituretypetable.htm" + }, + "Pset_HeatExchangerTypeCommon": { + "properties": { + "Arrangement": { + "description": "Defines the basic flow arrangements for the heat exchanger:" + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_heatexchangertypecommon.htm" + }, + "Pset_HeatExchangerTypePlate": { + "properties": { + "NumberOfPlates": { + "description": "Number of plates used by the plate heat exchanger." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_heatexchangertypeplate.htm" + }, + "Pset_HumidifierPHistory": { + "properties": { + "AtmosphericPressure": { + "description": "Ambient atmospheric pressure." + }, + "SaturationEfficiency": { + "description": "Saturation efficiency: Ratio of leaving air absolute humidity to the maximum absolute humidity." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_humidifierphistory.htm" + }, + "Pset_HumidifierTypeCommon": { + "properties": { + "AirPressureDropCurve": { + "description": "Air pressure drop versus air-flow rate." + }, + "Application": { + "description": "Humidifier application." + }, + "InternalControl": { + "description": "Internal modulation control." + }, + "NominalAirFlowRate": { + "description": "Nominal rate of air flow into which water vapor is added." + }, + "NominalMoistureGain": { + "description": "Nominal rate of water vapor added into the airstream." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "SaturationEfficiencyCurve": { + "description": "Saturation efficiency as a function of the air flow rate." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "WaterRequirement": { + "description": "Make-up water requirement." + }, + "Weight": { + "description": "The weight of the humidifier." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_humidifiertypecommon.htm" + }, + "Pset_InterceptorTypeCommon": { + "properties": { + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the oil interceptor." + }, + "CoverWidth": { + "description": "The length measured along the x-axis in the local coordinate system of the cover of the oil interceptor." + }, + "InletConnectionSize": { + "description": "Size of the inlet connection." + }, + "NominalBodyDepth": { + "description": "Nominal or quoted =length, measured along the z-axis of the local coordinate system of the object, of the body of the object." + }, + "NominalBodyLength": { + "description": "Nominal or quoted length, measured along the x-axis of the local coordinate system of the object, of the body of the object." + }, + "NominalBodyWidth": { + "description": "Nominal or quoted length, measured along the y-axis of the local coordinate system of the object, of the body of the object." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "VentilatingPipeSize": { + "description": "Size of the ventilating pipe(s)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_interceptortypecommon.htm" + }, + "Pset_JunctionBoxTypeCommon": { + "properties": { + "ClearDepth": { + "description": "Clear unobstructed depth available for cable inclusion within the junction box." + }, + "IP_Code": { + "description": "IEC 60529 (1989) Classification of degrees of protection provided by enclosures (IP Code)." + }, + "IsExternal": { + "description": "Indication of whether the junction box type is allowed for exposure to outdoor elements (set TRUE where external exposure is allowed)." + }, + "MountingType": { + "description": "Method of mounting to be adopted for the type of junction box." + }, + "NumberOfGangs": { + "description": "Number of slots available for switches/outlets (most commonly 1, 2, 3, or 4)." + }, + "PlacingType": { + "description": "Location at which the type of junction box can be located." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "ShapeType": { + "description": "Shape of the junction box." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_junctionboxtypecommon.htm" + }, + "Pset_LampTypeCommon": { + "properties": { + "ColorAppearance": { + "description": "In both the DIN and CIE standards, artificial light sources are classified in terms of their color appearance. To the human eye they all appear to be white; the difference can only be detected by direct comparison. Visual performance is not directly affected by differences in color appearance." + }, + "ColorRenderingIndex": { + "description": "The CRI indicates how well a light source renders eight standard colors compared to perfect reference lamp with the same color temperature. The CRI scale ranges from 1 to 100, with 100 representing perfect rendering properties." + }, + "ColorTemperature": { + "description": "The color temperature of any source of radiation is defined as the temperature (in Kelvin) of a black-body or Planckian radiator whose radiation has the same chromaticity as the source of radiation. Often the values are only approximate color temperatures as the black-body radiator cannot emit radiation of every chromaticity value. The color temperatures of the commonest artificial light sources range from less than 3000K (warm white) to 4000K (intermediate) and over 5000K (daylight)." + }, + "ContributedLuminousFlux": { + "description": "Luminous flux is a photometric measure of radiant flux, i.e. the volume of light emitted from a light source. Luminous flux is measured either for the interior as a whole or for a part of the interior (partial luminous flux for a solid angle). All other photometric parameters are derivatives of luminous flux. Luminous flux is measured in lumens (lm). The luminous flux is given as a nominal value for each lamp." + }, + "LampBallastType": { + "description": "The type of ballast used to stabilise gas discharge by limiting the current during operation and to deliver the necessary striking voltage for starting. Ballasts are needed to operate Discharge Lamps such as Fluorescent, Compact Fluorescent, High-pressure Mercury, Metal Halide and High-pressure Sodium Lamps. Magnetic ballasts are chokes which limit the current passing through a lamp connected in series on the principle of self-induction. The resultant current and power are decisive for the efficient operation of the lamp. A specially designed ballast is required for every type of lamp to comply with lamp rating in terms of Luminous Flux, Color Appearance and service life. The two types of magnetic ballasts for fluorescent lamps are KVG Conventional (EC-A series) and VVG Low-loss ballasts (EC-B series). Low-loss ballasts have a higher efficiency, which means reduced ballast losses and a lower thermal load. Electronic ballasts are used to run fluorescent lamps at high frequencies (approx. 35 - 40 kHz)." + }, + "LampCompensationType": { + "description": "Identifies the form of compensation used for power factor correction and radio suppression." + }, + "LampMaintenanceFactor": { + "description": "Non recoverable losses of luminous flux of a lamp due to lamp depreciation; i.e. the decreasing of light output of a luminaire due to aging and dirt." + }, + "LightEmitterNominalPower": { + "description": "Light emitter nominal power." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Spectrum": { + "description": "The spectrum of radiation describes its composition with regard to wavelength. Light, for example, as the portion of electromagnetic radiation that is visible to the human eye, is radiation with wavelengths in the range of approx. 380 to 780 nm (1 nm = 10 m). The corresponding range of colours varies from violet to indigo, blue, green, yellow, orange, and red. These colours form a continuous spectrum, in which the various spectral sectors merge into each other." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_lamptypecommon.htm" + }, + "Pset_LandRegistration": { + "properties": { + "IsPermanentID": { + "description": "Indicates whether the identity assigned to a land parcel is permanent (= TRUE) or temporary (=FALSE)." + }, + "LandID": { + "description": "Identification number assigned by the statutory registration authority to a land parcel." + }, + "LandTitleID": { + "description": "Identification number assigned by the statutory registration authority to the title to a land parcel." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_landregistration.htm" + }, + "Pset_LightFixtureTypeCommon": { + "properties": { + "LightFixtureMountingType": { + "description": "A list of the available types of mounting for light fixtures from which that required may be selected." + }, + "LightFixturePlacingType": { + "description": "A list of the available types of placing specification for light fixtures from which that required may be selected." + }, + "MaintenanceFactor": { + "description": "The arithmetical allowance made for depreciation of lamps and reflective equipment from their initial values due to dirt, fumes, or age." + }, + "MaximumPlenumSensibleLoad": { + "description": "Maximum or Peak sensible thermal load contributed to return air plenum by the light fixture." + }, + "MaximumSpaceSensibleLoad": { + "description": "Maximum or Peak sensible thermal load contributed to the conditioned space by the light fixture." + }, + "NumberOfSources": { + "description": "Number of sources ." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "SensibleLoadToRadiant": { + "description": "Percent of sensible thermal load to radiant heat." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TotalWattage": { + "description": "Wattage on whole lightfitting device with all sources intact." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_lightfixturetypecommon.htm" + }, + "Pset_LightFixtureTypeSecurityLighting": { + "properties": { + "Addressablility": { + "description": "The type of addressability." + }, + "BackupSupplySystem": { + "description": "The type of backup supply system." + }, + "FixtureHeight": { + "description": "The height of the fixture, such as the text height of an exit sign." + }, + "PictogramEscapeDirection": { + "description": "The direction of escape pictogram." + }, + "SecurityLightingType": { + "description": "The type of security lighting." + }, + "SelfTestFunction": { + "description": "The type of self test function." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_lightfixturetypesecuritylighting.htm" + }, + "Pset_ManufacturerOccurrence": { + "properties": { + "AcquisitionDate": { + "description": "The date that the manufactured item was purchased." + }, + "AssemblyPlace": { + "description": "Enumeration defining where the assembly is intended to take place, either in a factory, other offsite location or on the building site." + }, + "BarCode": { + "description": "The identity of the bar code given to an occurrence of the product." + }, + "BatchReference": { + "description": "The identity of the batch reference from which an occurrence of a product is taken." + }, + "SerialNumber": { + "description": "The serial number assigned to an occurrence of a product." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_manufactureroccurrence.htm" + }, + "Pset_ManufacturerTypeInformation": { + "properties": { + "ArticleNumber": { + "description": "Article number or reference that is be applied to a configured product according to a standard scheme for article number definition as defined by the manufacturer. It is often used as the purchasing number." + }, + "AssemblyPlace": { + "description": "Enumeration defining where the assembly is intended to take place, either in a factory or on the building site." + }, + "GlobalTradeItemNumber": { + "description": "The Global Trade Item Number (GTIN) is an identifier for trade items developed by GS1 (www.gs1.org)." + }, + "Manufacturer": { + "description": "The organization that manufactured and/or assembled the item." + }, + "ModelLabel": { + "description": "The descriptive model name of the product model (or product line) as assigned by the manufacturer of the manufactured item." + }, + "ModelReference": { + "description": "The model number or designator of the product model (or product line) as assigned by the manufacturer of the manufactured item." + }, + "ProductionYear": { + "description": "The year of production of the manufactured item." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_manufacturertypeinformation.htm" + }, + "Pset_MaterialCombustion": { + "properties": { + "CO2Content": { + "description": "Carbon dioxide (CO2) content of the products of combustion. This is measured in weight of CO2 per unit weight and is therefore unitless." + }, + "COContent": { + "description": "Carbon monoxide (CO) content of the products of combustion. This is measured in weight of CO per unit weight and is therefore unitless." + }, + "N20Content": { + "description": "Nitrous oxide (N2O) content of the products of combustion. This is measured in weight of N2O per unit weight and is therefore unitless." + }, + "SpecificHeatCapacity": { + "description": "Specific heat of the products of combustion: heat energy absorbed per temperature unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialcombustion.htm" + }, + "Pset_MaterialCommon": { + "properties": { + "MassDensity": { + "description": "Material mass density." + }, + "MolecularWeight": { + "description": "Molecular weight of material (typically gas)." + }, + "Porosity": { + "description": "The void fraction of the total volume occupied by material (Vbr - Vnet)/Vbr." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialcommon.htm" + }, + "Pset_MaterialConcrete": { + "properties": { + "AdmixturesDescription": { + "description": "Description of the admixtures added to the concrete mix." + }, + "CompressiveStrength": { + "description": "The compressive strength of the concrete." + }, + "MaxAggregateSize": { + "description": "The maximum aggregate size of the concrete." + }, + "ProtectivePoreRatio": { + "description": "The protective pore ratio indicating the frost-resistance of the concrete." + }, + "WaterImpermeability": { + "description": "Description of the water impermeability denoting the water repelling properties." + }, + "Workability": { + "description": "Description of the workability of the fresh concrete defined according to local standards." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialconcrete.htm" + }, + "Pset_MaterialEnergy": { + "properties": { + "GasPressure": { + "description": "Fill pressure (e.g. for between-pane gas fills): the pressure exerted by a mass of gas confined in a constant volume." + }, + "MoistureCapacityThermalGradient": { + "description": "Thermal gradient coefficient for moisture capacity. Based on water vapor density." + }, + "SolarRefractionIndex": { + "description": "Index of refraction (solar) defines the \"bending\" of the solar ray when it passes from one medium into another." + }, + "SpecificHeatTemperatureDerivative": { + "description": "Specific heat temperature derivative." + }, + "ThermalConductivityTemperatureDerivative": { + "description": "Thermal conductivity temperature derivative." + }, + "ViscosityTemperatureDerivative": { + "description": "Viscosity temperature derivative." + }, + "VisibleRefractionIndex": { + "description": "Index of refraction (visible) defines the \"bending\" of the sola! r ray in the visible spectrum when it passes from one medium into another." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialenergy.htm" + }, + "Pset_MaterialFuel": { + "properties": { + "CarbonContent": { + "description": "The carbon content in the fuel. This is measured in weight of carbon per unit weight of fuel and is therefore unitless." + }, + "CombustionTemperature": { + "description": "Combustion temperature of the material when air is at 298 K and 100 kPa." + }, + "HigherHeatingValue": { + "description": "Higher Heating Value is defined as the amount of energy released (MJ/kg) when a fuel is burned completely, and H2O is in liquid form in the combustion products." + }, + "LowerHeatingValue": { + "description": "Lower Heating Value is defined as the amount of energy released (MJ/kg) when a fuel is burned completely, and H2O is in vapor form in the combustion products." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialfuel.htm" + }, + "Pset_MaterialHygroscopic": { + "properties": { + "IsothermalMoistureCapacity": { + "description": "Based on water vapor density." + }, + "LowerVaporResistanceFactor": { + "description": "The vapor permeability relationship of air/material (typically value > 1), measured in low relative humidity (typically in 0/50 % RH)." + }, + "MoistureDiffusivity": { + "description": "Moisture diffusivity is a transport property that is frequently used in the hygrothermal analysis of building envelope components." + }, + "UpperVaporResistanceFactor": { + "description": "The vapor permeability relationship of air/material (typically value > 1), measured in high relative humidity (typically in 95/50 % RH)." + }, + "VaporPermeability": { + "description": "The rate of water vapor transmission per unit area per unit of vapor pressure differential under test conditions." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialhygroscopic.htm" + }, + "Pset_MaterialMechanical": { + "properties": { + "DynamicViscosity": { + "description": "A measure of the viscous resistance of the material." + }, + "PoissonRatio": { + "description": "A measure of the lateral deformations in the elastic range." + }, + "ShearModulus": { + "description": "A measure of the shear modulus of elasticity of the material." + }, + "ThermalExpansionCoefficient": { + "description": "A measure of the expansion coefficient for warming up the material about one Kelvin." + }, + "YoungModulus": { + "description": "A measure of the Young's modulus of elasticity of the material." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialmechanical.htm" + }, + "Pset_MaterialOptical": { + "properties": { + "SolarReflectanceBack": { + "description": "Reflectance at normal incidence (solar): back side. Defines the fraction of the solar ray that is reflected and not transmitted when the ray passes from one medium into another, at the \"back\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics." + }, + "SolarReflectanceFront": { + "description": "Reflectance at normal incidence (solar): front side. Defines the fraction of the solar ray that is reflected and not transmitted when the ray passes from one medium into another, at the \"front\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics." + }, + "SolarTransmittance": { + "description": "Transmittance at normal incidence (solar). Defines the fraction of solar radiation that passes through per unit area, perpendicular to the surface." + }, + "ThermalIrEmissivityBack": { + "description": "Thermal IR emissivity: back side. Defines the fraction of thermal energy emitted per unit area to \"blackbody\" at the same temperature, through the \"back\" side of the material." + }, + "ThermalIrEmissivityFront": { + "description": "Thermal IR emissivity: front side. Defines the fraction of thermal energy emitted per unit area to \"blackbody\" at the same temperature, through the \"front\" side of the material." + }, + "ThermalIrTransmittance": { + "description": "Thermal IR transmittance at normal incidence. Defines the fraction of thermal energy that passes through per unit area, perpendicular to the surface." + }, + "VisibleReflectanceBack": { + "description": "Reflectance at normal incidence (visible): back side. Defines the fraction of the solar ray in the visible spectrum that is reflected and not transmitted when the ray passes from one medium into another, at the \"back\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics." + }, + "VisibleReflectanceFront": { + "description": "Reflectance at normal incidence (visible): front side. Defines the fraction of the solar ray in the visible spectrum that is reflected and not transmitted when the ray passes from one medium into another, at the \"front\" side of the other material, perpendicular to the surface. Dependent on material and surface characteristics." + }, + "VisibleTransmittance": { + "description": "Transmittance at normal incidence (visible). Defines the fraction of the visible spectrum of solar radiation that passes through per unit area, perpendicular to the surface." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialoptical.htm" + }, + "Pset_MaterialSteel": { + "properties": { + "HardeningModule": { + "description": "A measure of the hardening module of the material (slope of stress versus strain curve after yield range)." + }, + "PlasticStrain": { + "description": "A measure of the permanent displacement, as in slip or twinning, which remains after the stress has been removed. Currently applied to a strain of 0.2% proportional stress of the material." + }, + "ProportionalStress": { + "description": "A measure of the proportional stress of the material. It describes the stress before the first plastic deformation occurs and is commonly measured at a deformation of 0.01%." + }, + "Relaxations": { + "description": "Measures of decrease in stress over long time intervals resulting from plastic flow. Different relaxation values for different initial stress levels for a material may be given. It describes the time dependent relative relaxation value for a given initial stress level at constant strain. Relating values are the \"RelaxationValue\". Related values are the \"InitialStress\"" + }, + "UltimateStrain": { + "description": "A measure of the (engineering) strain at the state of ultimate stress of the material." + }, + "UltimateStress": { + "description": "A measure of the ultimate stress of the material." + }, + "YieldStress": { + "description": "A measure of the yield stress (or characteristic 0.2 percent proof stress) of the material." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialsteel.htm" + }, + "Pset_MaterialThermal": { + "properties": { + "BoilingPoint": { + "description": "The boiling point of the material (fluid)." + }, + "FreezingPoint": { + "description": "The freezing point of the material (fluid)." + }, + "SpecificHeatCapacity": { + "description": "Defines the specific heat of the material: heat energy absorbed per temperature unit." + }, + "ThermalConductivity": { + "description": "The rate at which thermal energy is transmitted through the material." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialthermal.htm" + }, + "Pset_MaterialWater": { + "properties": { + "AcidityConcentration": { + "description": "Maximum CaCO3 equivalent that would neutralize the acid." + }, + "AlkalinityConcentration": { + "description": "Maximum alkalinity concentration (maximum sum of concentrations of each of the negative ions substances measured as CaCO3)." + }, + "DissolvedSolidsContent": { + "description": "Fraction of the dissolved solids to the total amount of water. This is measured in weight of dissolved solids per weight of water and is therefore unitless." + }, + "Hardness": { + "description": "Water hardness as positive, multivalent ion concentration in the water (usually concentrations of calcium and magnesium ions in terms of calcium carbonate)." + }, + "ImpuritiesContent": { + "description": "Fraction of impurities such as dust to the total amount of water. This is measured in weight of impurities per weight of water and is therefore unitless." + }, + "IsPotable": { + "description": "If TRUE, then the water is considered potable." + }, + "PHLevel": { + "description": "Maximum water PH in a range from 0-14." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialwater.htm" + }, + "Pset_MaterialWood": { + "properties": { + "AppearanceGrade": { + "description": "Grade with respect to visual quality." + }, + "DimensionalChangeCoefficient": { + "description": "Weighted dimensional change coefficient, relative to 1% change in moisture content." + }, + "Layers": { + "description": "Number of layers." + }, + "Layup": { + "description": "Configuration of the lamination." + }, + "MoistureContent": { + "description": "Total weight of moisture relative to oven-dried weight of the wood." + }, + "Plies": { + "description": "Number of plies." + }, + "Species": { + "description": "Wood species of a solid wood or laminated wood product." + }, + "StrengthGrade": { + "description": "Grade with respect to mechanical strength and stiffness." + }, + "ThicknessSwelling": { + "description": "Swelling ratio relative to board depth." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialwood.htm" + }, + "Pset_MaterialWoodBasedBeam": { + "properties": { + "ApplicableStructuralDesignMethod": { + "description": "Determines whether mechanical material properties are applicable to 'ASD' = allowable stress design (working stress design), 'LSD' = limit state design, or 'LRFD' = load and resistance factor design." + }, + "InPlane": { + "children": { + "BendingStrength": { + "description": "Bending strength." + }, + "CompStrength": { + "description": "Compressive strength, \u03b1=0\u00b0." + }, + "CompStrengthPerp": { + "description": "Compressive strength, \u03b1=90\u00b0." + }, + "InstabilityFactors": { + "description": "Defining values: slenderness ratios; defined values: either factors or divisors of the strength, depending on the design method (if <1: factors, if >1: divisors)." + }, + "RaisedCompStrengthPerp": { + "description": "Alternative value for compressive strength, \u03b1=90\u00b0, which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus, mean value." + }, + "ShearModulusMin": { + "description": "Shear modulus, minimal value." + }, + "ShearStrength": { + "description": "Shear strength." + }, + "TensileStrength": { + "description": "Tensile strength, \u03b1=0\u00b0." + }, + "TensileStrengthPerp": { + "description": "Tensile strength, \u03b1=90\u00b0." + }, + "TorsionalStrength": { + "description": "Shear strength in torsion." + }, + "YoungModulus": { + "description": "Elastic modulus, mean value, \u03b1=0\u00b0." + }, + "YoungModulusMin": { + "description": "Elastic modulus, minimal value, \u03b1=0\u00b0." + }, + "YoungModulusPerp": { + "description": "Elastic modulus, mean value, \u03b1=90\u00b0." + }, + "YoungModulusPerpMin": { + "description": "Elastic modulus, minimal value, \u03b1=90\u00b0." + } + }, + "description": "Mechanical properties with respect to in-plane load, i.e. bending about the strong axis; tension zone of unbalanced layups is stressed in tension." + }, + "InPlaneNegative": { + "children": { + "BendingStrength": { + "description": "Bending strength." + }, + "CompStrength": { + "description": "Compressive strength, \u03b1=0\u00b0." + }, + "CompStrengthPerp": { + "description": "Compressive strength, \u03b1=90\u00b0." + }, + "InstabilityFactors": { + "description": "Defining values: slenderness ratios; defined values: either factors or divisors of the strength, depending on the design method (if <1: factors, if >1: divisors)." + }, + "RaisedCompStrengthPerp": { + "description": "Alternative value for compressive strength, \u03b1=90\u00b0, which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus, mean value." + }, + "ShearModulusMin": { + "description": "Shear modulus, minimal value." + }, + "ShearStrength": { + "description": "Shear strength." + }, + "TensileStrength": { + "description": "Tensile strength, \u03b1=0\u00b0." + }, + "TensileStrengthPerp": { + "description": "Tensile strength, \u03b1=90\u00b0." + }, + "TorsionalStrength": { + "description": "Shear strength in torsion." + }, + "YoungModulus": { + "description": "Elastic modulus, mean value, \u03b1=0\u00b0." + }, + "YoungModulusMin": { + "description": "Elastic modulus, minimal value, \u03b1=0\u00b0." + }, + "YoungModulusPerp": { + "description": "Elastic modulus, mean value, \u03b1=90\u00b0." + }, + "YoungModulusPerpMin": { + "description": "Elastic modulus, minimal value, \u03b1=90\u00b0." + } + }, + "description": "Mechanical properties with respect to in-plane load, i.e. bending about the strong axis; compression zone of unbalanced layups is stressed in tension." + }, + "OutOfPlane": { + "children": { + "BendingStrength": { + "description": "Bending strength." + }, + "CompStrength": { + "description": "Compressive strength, \u03b1=0\u00b0." + }, + "CompStrengthPerp": { + "description": "Compressive strength, \u03b1=90\u00b0." + }, + "InstabilityFactors": { + "description": "Defining values: slenderness ratios; defined values: either factors or divisors of the strength, depending on the design method (if <1: factors, if >1: divisors)." + }, + "RaisedCompStrengthPerp": { + "description": "Alternative value for compressive strength, \u03b1=90\u00b0, which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus, mean value." + }, + "ShearModulusMin": { + "description": "Shear modulus, minimal value." + }, + "ShearStrength": { + "description": "Shear strength." + }, + "TensileStrength": { + "description": "Tensile strength, \u03b1=0\u00b0." + }, + "TensileStrengthPerp": { + "description": "Tensile strength, \u03b1=90\u00b0." + }, + "TorsionalStrength": { + "description": "Shear strength in torsion." + }, + "YoungModulus": { + "description": "Elastic modulus, mean value, \u03b1=0\u00b0." + }, + "YoungModulusMin": { + "description": "Elastic modulus, minimal value, \u03b1=0\u00b0." + }, + "YoungModulusPerp": { + "description": "Elastic modulus, mean value, \u03b1=90\u00b0." + }, + "YoungModulusPerpMin": { + "description": "Elastic modulus, minimal value, \u03b1=90\u00b0." + } + }, + "description": "Mechanical properties with respect to out-of-plane load, i.e. bending about the weak axis." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialwoodbasedbeam.htm" + }, + "Pset_MaterialWoodBasedPanel": { + "properties": { + "ApplicableStructuralDesignMethod": { + "description": "Determines whether mechanical material properties are applicable to 'ASD' = allowable stress design (working stress design), 'LSD' = limit state design, or 'LRFD' = load and resistance factor design." + }, + "InPlane": { + "children": { + "BearingStrength": { + "description": "Defining values: \u03b1; defined values: bearing strength of bolt holes, i.e. intrados pressure." + }, + "BendingStrength": { + "description": "Defining values: \u03b1; defined values: bending strength." + }, + "CompressiveStrength": { + "description": "Defining values: \u03b1; defined values: compressive strength." + }, + "RaisedCompressiveStrength": { + "description": "Alternative value for compressive strength which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus." + }, + "ShearStrength": { + "description": "Defining values: \u03b1; defined values: shear strength." + }, + "TensileStrength": { + "description": "Defining values: \u03b1; defined values: tensile strength." + }, + "YoungModulusBending": { + "description": "Defining values: \u03b1; defined values: elastic modulus in bending." + }, + "YoungModulusCompression": { + "description": "Elastic modulus in compression." + }, + "YoungModulusTension": { + "description": "Defining values: \u03b1; defined values: elastic modulus in tension." + } + }, + "description": "Mechanical properties with respect to in-plane load, i.e. for function as a membrane." + }, + "OutOfPlane": { + "children": { + "BearingStrength": { + "description": "Defining values: \u03b1; defined values: bearing strength of bolt holes, i.e. intrados pressure." + }, + "BendingStrength": { + "description": "Defining values: \u03b1; defined values: bending strength." + }, + "CompressiveStrength": { + "description": "Defining values: \u03b1; defined values: compressive strength." + }, + "RaisedCompressiveStrength": { + "description": "Alternative value for compressive strength which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus." + }, + "ShearStrength": { + "description": "Defining values: \u03b1; defined values: shear strength." + }, + "TensileStrength": { + "description": "Defining values: \u03b1; defined values: tensile strength." + }, + "YoungModulusBending": { + "description": "Defining values: \u03b1; defined values: elastic modulus in bending." + }, + "YoungModulusCompression": { + "description": "Elastic modulus in compression." + }, + "YoungModulusTension": { + "description": "Defining values: \u03b1; defined values: elastic modulus in tension." + } + }, + "description": "Mechanical properties with respect to out-of-plane load, i.e. for function as a plate; tension zone of unbalanced layups is stressed in tension." + }, + "OutOfPlaneNegative": { + "children": { + "BearingStrength": { + "description": "Defining values: \u03b1; defined values: bearing strength of bolt holes, i.e. intrados pressure." + }, + "BendingStrength": { + "description": "Defining values: \u03b1; defined values: bending strength." + }, + "CompressiveStrength": { + "description": "Defining values: \u03b1; defined values: compressive strength." + }, + "RaisedCompressiveStrength": { + "description": "Alternative value for compressive strength which may be used under material and code dependent conditions (e.g. if deformation is tolerable, or far from ends of the member); conditions should be stated in SELF\\IfcProperty.Description." + }, + "ReferenceDepth": { + "description": "Depth in bending for which the mechanical properties are valid; provided as a means to check the integrity of material assignment." + }, + "ShearModulus": { + "description": "Shear modulus." + }, + "ShearStrength": { + "description": "Defining values: \u03b1; defined values: shear strength." + }, + "TensileStrength": { + "description": "Defining values: \u03b1; defined values: tensile strength." + }, + "YoungModulusBending": { + "description": "Defining values: \u03b1; defined values: elastic modulus in bending." + }, + "YoungModulusCompression": { + "description": "Elastic modulus in compression." + }, + "YoungModulusTension": { + "description": "Defining values: \u03b1; defined values: elastic modulus in tension." + } + }, + "description": "Mechanical properties with respect to out-of-plane load i.e. for function as a plate; compression zone of unbalanced layups is stressed in tension." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcmaterialresource/pset/pset_materialwoodbasedpanel.htm" + }, + "Pset_MechanicalFastenerAnchorBolt": { + "properties": { + "AnchorBoltDiameter": { + "description": "The nominal diameter of the anchor bolt bar(s)." + }, + "AnchorBoltLength": { + "description": "The length of the anchor bolt." + }, + "AnchorBoltProtrusionLength": { + "description": "The length of the protruding part of the anchor bolt." + }, + "AnchorBoltThreadLength": { + "description": "The length of the threaded part of the anchor bolt." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_mechanicalfasteneranchorbolt.htm" + }, + "Pset_MechanicalFastenerBolt": { + "properties": { + "HeadShape": { + "description": "Shape of the bolt's head, e.g. 'Hexagon', 'Countersunk', 'Cheese'" + }, + "KeyShape": { + "description": "If applicable, shape of the head's slot, e.g. 'Slot', 'Allen'" + }, + "NutShape": { + "description": "Shape of the nut, e.g. 'Hexagon', 'Cap', 'Castle', 'Wing'" + }, + "NutsCount": { + "description": "Count of nuts to be mounted on one bolt" + }, + "ThreadDiameter": { + "description": "Nominal diameter of the thread, if different from the bolt's overall nominal diameter" + }, + "ThreadLength": { + "description": "Nominal length of the thread" + }, + "WasherShape": { + "description": "Shape of the washers, e.g. 'Standard', 'Square'" + }, + "WashersCount": { + "description": "Count of washers to be mounted on one bolt" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_mechanicalfastenerbolt.htm" + }, + "Pset_MechanicalFastenerCommon": { + "properties": { + "NominalDiameter": { + "description": "The nominal diameter describing the cross-section size of the fastener type." + }, + "NominalLength": { + "description": "The nominal length describing the longitudinal dimensions of the fastener type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedcomponentelements/pset/pset_mechanicalfastenercommon.htm" + }, + "Pset_MedicalDeviceTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_medicaldevicetypecommon.htm" + }, + "Pset_MemberCommon": { + "properties": { + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Roll": { + "description": "Rotation against the longitudinal axis - relative to the global Z direction for all members that are non-vertical in regard to the global coordinate system (Profile direction equals global Z is Roll = 0.) The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence. Note: new property in IFC4." + }, + "Slope": { + "description": "Slope angle - relative to horizontal (0.0 degrees). The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "Span": { + "description": "Clear span for this object. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Here the total thermal transmittance coefficient through the member within the direction of the thermal flow (including all materials). Note: new property in IFC4." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_membercommon.htm" + }, + "Pset_MotorConnectionTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_motorconnectiontypecommon.htm" + }, + "Pset_OpeningElementCommon": { + "properties": { + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here whether the space (in case of e.g., a corridor) is designed to serve as an exit space, e.g., for fire escape purposes." + }, + "ProtectedOpening": { + "description": "Indication whether the opening is considered to be protected under fire safety considerations. If (TRUE) it counts as a protected opening under the applicable building code, (FALSE) otherwise." + }, + "Purpose": { + "description": "Indication of the purpose for that opening, e.g. 'ventilation', 'access', etc." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal construction type." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_openingelementcommon.htm" + }, + "Pset_OutletTypeCommon": { + "properties": { + "IsPluggableOutlet": { + "description": "Indication of whether the outlet accepts a loose plug connection (= TRUE) or whether it is directly connected (= FALSE) or whether the form of connection has not yet been determined (= UNKNOWN)." + }, + "NumberOfSockets": { + "description": "The number of sockets that may be connected. In case of inconsistency, sockets defined on ports take precedence." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_outlettypecommon.htm" + }, + "Pset_OutsideDesignCriteria": { + "properties": { + "BuildingThermalExposure": { + "description": "The thermal exposure expected by the building based on surrounding site conditions." + }, + "CoolingDesignDay": { + "description": "The month, day and time that has been selected for the cooling design calculations." + }, + "CoolingDryBulb": { + "description": "Outside dry bulb temperature for cooling design." + }, + "CoolingWetBulb": { + "description": "Outside wet bulb temperature for cooling design." + }, + "HeatingDesignDay": { + "description": "The month, day and time that has been selected for the heating design calculations." + }, + "HeatingDryBulb": { + "description": "Outside dry bulb temperature for heating design." + }, + "HeatingWetBulb": { + "description": "Outside wet bulb temperature for heating design." + }, + "PrevailingWindDirection": { + "description": "The prevailing wind angle direction measured from True North (0 degrees) in a clockwise direction." + }, + "PrevailingWindVelocity": { + "description": "The design wind velocity coming from the direction specified by the PrevailingWindDirection attribute." + }, + "WeatherDataDate": { + "description": "The date for which the weather data was gathered." + }, + "WeatherDataStation": { + "description": "The site weather data station description or reference to the data source from which weather data was obtained for use in calculations." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_outsidedesigncriteria.htm" + }, + "Pset_PackingInstructions": { + "properties": { + "ContainerMaterial": { + "description": "Special requirements for material used to contain an artefact." + }, + "PackingCareType": { + "description": "Identifies the predefined types of care that may be required when handling the artefact during a move where:" + }, + "SpecialInstructions": { + "description": "Special instructions for packing." + }, + "WrappingMaterial": { + "description": "Special requirements for material used to wrap an artefact." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_packinginstructions.htm" + }, + "Pset_Permit": { + "properties": { + "EndDate": { + "description": "Date and time at which the permit ceases to be valid." + }, + "EscortRequirement": { + "description": "Indicates whether or not an escort is required to accompany persons carrying out a work order at or to/from the place of work (= TRUE) or not (= FALSE)." + }, + "SpecialRequirements": { + "description": "Any additional special requirements that need to be included in the permit to work." + }, + "StartDate": { + "description": "Date and time from which the permit becomes valid." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_permit.htm" + }, + "Pset_PileCommon": { + "properties": { + "LoadBearing": {}, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_pilecommon.htm" + }, + "Pset_PipeConnectionFlanged": { + "properties": { + "BoltSize": { + "description": "Size of the bolts securing the flange." + }, + "BoltholePitch": { + "description": "Diameter of the circle along which the boltholes are placed." + }, + "BoreSize": { + "description": "The nominal bore of the pipe flange." + }, + "FlangeDiameter": { + "description": "Overall diameter of the flange." + }, + "FlangeStandard": { + "description": "Designation of the standard describing the flange table." + }, + "FlangeTable": { + "description": "Designation of the standard table to which the flange conforms." + }, + "FlangeThickness": { + "description": "Thickness of the material from which the pipe bend is constructed." + }, + "NumberOfBoltholes": { + "description": "Number of boltholes in the flange." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipeconnectionflanged.htm" + }, + "Pset_PipeFittingOccurrence": { + "properties": { + "Color": { + "description": "The color of the pipe segment." + }, + "InteriorRoughnessCoefficient": { + "description": "The interior roughness coefficient of the pipe segment." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipefittingoccurrence.htm" + }, + "Pset_PipeFittingPHistory": { + "properties": { + "FlowrateLeakage": { + "description": "Leakage flowrate versus pressure difference." + }, + "LossCoefficient": { + "description": "Dimensionless loss coefficient used for calculating fluid resistance representing the ratio of total pressure loss to velocity pressure at a referenced cross-section." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipefittingphistory.htm" + }, + "Pset_PipeFittingTypeBend": { + "properties": { + "BendAngle": { + "description": "The change of direction of flow." + }, + "BendRadius": { + "description": "The radius of bending if circular arc or zero if sharp bend." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipefittingtypebend.htm" + }, + "Pset_PipeFittingTypeCommon": { + "properties": { + "FittingLossFactor": { + "description": "A factor that determines the pressure loss due to friction through the fitting." + }, + "PressureClass": { + "description": "The test or rated pressure classification of the fitting." + }, + "PressureRange": { + "description": "Allowable maximum and minimum working pressure (relative to ambient pressure)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable maximum and minimum temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipefittingtypecommon.htm" + }, + "Pset_PipeFittingTypeJunction": { + "properties": { + "JunctionLeftAngle": { + "description": "The change of direction of flow for the left junction." + }, + "JunctionLeftRadius": { + "description": "The radius of bending for the left junction." + }, + "JunctionRightAngle": { + "description": "The change of direction of flow for the right junction where 0 indicates straight segment." + }, + "JunctionRightRadius": { + "description": "The radius of bending for the right junction where 0 indicates sharp bend." + }, + "JunctionType": { + "description": "The type of junction. TEE=3 ports, CROSS = 4 ports." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipefittingtypejunction.htm" + }, + "Pset_PipeSegmentOccurrence": { + "properties": { + "Color": { + "description": "The color of the pipe segment." + }, + "Gradient": { + "description": "The gradient of the pipe segment." + }, + "InteriorRoughnessCoefficient": { + "description": "The interior roughness coefficient of the pipe segment." + }, + "InvertElevation": { + "description": "The invert elevation relative to the datum established for the project." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipesegmentoccurrence.htm" + }, + "Pset_PipeSegmentPHistory": { + "properties": { + "FluidFlowLeakage": { + "description": "Volumetric leakage flow rate." + }, + "LeakageCurve": { + "description": "Leakage per unit length curve versus working pressure." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipesegmentphistory.htm" + }, + "Pset_PipeSegmentTypeCommon": { + "properties": { + "InnerDiameter": { + "description": "The actual inner diameter of the pipe." + }, + "NominalDiameter": { + "description": "The nominal diameter of the pipe segment." + }, + "OuterDiameter": { + "description": "The actual outer diameter of the pipe." + }, + "PressureRange": { + "description": "Allowable maximum and minimum working pressure (relative to ambient pressure)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable maximum and minimum temperature." + }, + "WorkingPressure": { + "description": "Working pressure." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipesegmenttypecommon.htm" + }, + "Pset_PipeSegmentTypeCulvert": { + "properties": { + "ClearDepth": { + "description": "The clear depth of the culvert." + }, + "InternalWidth": { + "description": "The internal width of the culvert." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipesegmenttypeculvert.htm" + }, + "Pset_PipeSegmentTypeGutter": { + "properties": { + "FlowRating": { + "description": "Actual flow capacity for the gutter. Value of 0.00 means this value has not been set." + }, + "Slope": { + "description": "Angle of the gutter to allow for drainage." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pipesegmenttypegutter.htm" + }, + "Pset_PlateCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. It applies to the total door construction." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_platecommon.htm" + }, + "Pset_PrecastConcreteElementFabrication": { + "properties": { + "ActualErectionDate": { + "description": "Date erected." + }, + "ActualProductionDate": { + "description": "Production date (stripped from form)." + }, + "AsBuiltLocationNumber": { + "description": "Defines a unique location within a structure, the \u2018slot\u2019 into which the piece was installed. Where pieces share the same piece mark, they can be interchanged. The value is only known after erection." + }, + "PieceMark": { + "description": "Defines a unique piece for production purposes. All pieces with the same piece mark value are identical and interchangeable. The piece mark may be composed of sub-parts that have specific locally defined meaning (e.g. B-1A may denote a beam, of generic type \u20181\u2019 and specific shape \u2018A\u2019)." + }, + "ProductionLotId": { + "description": "The manufacturer's production lot identifier." + }, + "SerialNumber": { + "description": "The manufacturer's serial number for the precast concrete element." + }, + "TypeDesignator": { + "description": "Type designator for the precast concrete element. The content depends on local standards. For instance in Finland it usually a one-letter acronym, e.g. P=Column, K=reinforced concrete beam,etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_precastconcreteelementfabrication.htm" + }, + "Pset_PrecastConcreteElementGeneral": { + "properties": { + "BatterAtEnd": { + "description": "The angle, in radians, by which the formwork at the ending face of a piece is to be rotated from the vertical in order to compensate for the rotation of the face that will occur once the piece is stripped from its form, inducing camber due to eccentric prestressing." + }, + "BatterAtStart": { + "description": "The angle, in radians, by which the formwork at the starting face of a piece is to be rotated from the vertical in order to compensate for the rotation of the face that will occur once the piece is stripped from its form, inducing camber due to eccentric prestressing." + }, + "CamberAtMidspan": { + "description": "The camber deflection, measured from the midpoint of a cambered face of a piece to the midpoint of the chord joining the ends of the same face, as shown in the figure below, divided by the original (nominal) straight length of the face of the piece." + }, + "CornerChamfer": { + "description": "The chamfer in the corners of the precast element. The chamfer is presumed to be equal in both directions." + }, + "DesignLocationNumber": { + "description": "Defines a unique location within a structure, the \u2018slot\u2019 for which the piece was designed." + }, + "FormStrippingStrength": { + "description": "The minimum required compressive strength of the concrete at form stripping time." + }, + "HollowCorePlugging": { + "description": "A descriptive label for how the hollow core ends are treated: they may be left open, closed with a plug, or sealed with cast concrete. Values would be, for example: 'Unplugged', 'Plugged', 'SealedWithConcrete'. This property applies to hollow core slabs only." + }, + "InitialTension": { + "description": "The initial stress of the tendon. This property applies to prestressed concrete elements only." + }, + "LiftingStrength": { + "description": "The minimum required compressive strength of the concrete when the concrete element is lifted." + }, + "ManufacturingToleranceClass": { + "description": "Classification designation of the manufacturing tolerances according to local standards." + }, + "MinimumAllowableSupportLength": { + "description": "The minimum allowable support length." + }, + "PieceMark": { + "description": "Defines a unique piece for production purposes. All pieces with the same piece mark value are identical and interchangeable. The piece mark may be composed of sub-parts that have specific locally defined meaning (e.g. B-1A may denote a beam, of generic type \u20181\u2019 and specific shape \u2018A\u2019)." + }, + "ReleaseStrength": { + "description": "The minimum required compressive strength of the concrete when the tendon stress is released. This property applies to prestressed concrete elements only." + }, + "Shortening": { + "description": "The ratio of the distance by which a precast piece is shortened after release from its form (due to compression induced by prestressing) to its original (nominal) length." + }, + "SupportDuringTransportDescription": { + "description": "Textual description of how the concrete element is supported during transportation." + }, + "SupportDuringTransportDocReference": { + "description": "Reference to an external document defining how the concrete element is supported during transportation." + }, + "TendonRelaxation": { + "description": "The maximum allowable relaxation of the tendon (usually expressed as %/1000 h).This property applies to prestressed concrete elements only." + }, + "TransportationStrength": { + "description": "The minimum required compressive strength of the concrete required for transportation." + }, + "Twisting": { + "description": "The angle, in radians, through which the end face of a precast piece is rotated with respect to its starting face, along its longitudinal axis, as a result of non-aligned supports. This measure is also termed the \u2018warping\u2019 angle." + }, + "TypeDesignator": { + "description": "Type designator for the precast concrete element. The content depends on local standards. For instance in Finland it usually a one-letter acronym, e.g. P=Column, K=reinforced concrete beam,etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_precastconcreteelementgeneral.htm" + }, + "Pset_PrecastSlab": { + "properties": { + "AngleBetweenComponentAxes": { + "description": "The angle between the axes of each pair of components." + }, + "AngleToFirstAxis": { + "description": "The angle of rotation of the axis of the first component relative to the \u2018West\u2019 edge of the slab." + }, + "DistanceBetweenComponentAxes": { + "description": "The distance between the axes of the components, measured along the \u2018South\u2019 edge of the slab." + }, + "EdgeDistanceToFirstAxis": { + "description": "The distance from the left (\u2018West\u2019) edge of the slab (in the direction of span of the components) to the axis of the first component." + }, + "NominalThickness": { + "description": "The nominal overall thickness of the slab." + }, + "NominalToppingThickness": { + "description": "The nominal thickness of the topping." + }, + "ToppingType": { + "description": "Defines if a topping is applied and what kind. Values are \u201cFull topping\u201d, \u201cPerimeter Wash\u201d, \u201cNone\u201d" + }, + "TypeDesignator": { + "description": "Type designator for the precast concrete slab, expressing mainly the component type. Possible values are \u201cHollow-core\u201d, \u201cDouble-tee\u201d, \u201cFlat plank\u201d, etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_precastslab.htm" + }, + "Pset_ProfileArbitraryDoubleT": { + "properties": { + "FlangeBaseFillet": { + "description": "Flange base fillet of the profile." + }, + "FlangeChamfer": { + "description": "Flange chamfer of the profile." + }, + "FlangeDepth": { + "description": "Flange depth of the profile." + }, + "FlangeDraft": { + "description": "Flange draft of the profile." + }, + "FlangeTopFillet": { + "description": "Flange top fillet of the profile." + }, + "LeftFlangeWidth": { + "description": "Left flange width of the profile." + }, + "OverallDepth": { + "description": "Overall depth of the profile." + }, + "OverallWidth": { + "description": "Overall width of the profile." + }, + "RightFlangeWidth": { + "description": "Right flange width of the profile." + }, + "StemBaseChamfer": { + "description": "Stem base chamfer of the profile." + }, + "StemBaseFillet": { + "description": "Stem base fillet of the profile." + }, + "StemBaseWidth": { + "description": "Stem base width of the profile." + }, + "StemTopChamfer": { + "description": "Stem top chamfer of the profile." + }, + "StemTopFillet": { + "description": "Stem top fillet of the profile." + }, + "StemTopWidth": { + "description": "Stem top width of the profile." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/pset/pset_profilearbitrarydoublet.htm" + }, + "Pset_ProfileArbitraryHollowCore": { + "properties": { + "BaseChamfer": { + "description": "Base chamfer of the profile." + }, + "BottomCover": { + "description": "Bottom cover of the profile." + }, + "CenterCoreBaseHeight": { + "description": "Center core base height of the profile." + }, + "CenterCoreBaseWidth": { + "description": "Center core base width of the profile." + }, + "CenterCoreMiddleHeight": { + "description": "Center core middle height of the profile." + }, + "CenterCoreSpacing": { + "description": "Center core spacing of the profile." + }, + "CenterCoreTopHeight": { + "description": "Center core top height of the profile." + }, + "CenterCoreTopWidth": { + "description": "Center core top width of the profile." + }, + "CoreBaseHeight": { + "description": "Core base height of the profile." + }, + "CoreBaseWidth": { + "description": "Core base width of the profile." + }, + "CoreMiddleHeight": { + "description": "Core middle height of the profile." + }, + "CoreSpacing": { + "description": "Core spacing of the profile." + }, + "CoreTopHeight": { + "description": "Core top height of the profile." + }, + "CoreTopWidth": { + "description": "Core top width of the profile." + }, + "DraftBaseOffset": { + "description": "Draft base offset of the profile." + }, + "DraftSideOffset": { + "description": "Draft side offset of the profile." + }, + "EdgeDraft": { + "description": "Edge draft of the profile." + }, + "KeyDepth": { + "description": "Key depth of the profile." + }, + "KeyHeight": { + "description": "Key height of the profile." + }, + "KeyOffset": { + "description": "Key offset of the profile." + }, + "NumberOfCores": { + "description": "Number of cores." + }, + "OverallDepth": { + "description": "Overall depth of the profile." + }, + "OverallWidth": { + "description": "Overall width of the profile." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/pset/pset_profilearbitraryhollowcore.htm" + }, + "Pset_ProfileMechanical": { + "properties": { + "CentreOfGravityInX": { + "description": "Location of the profile's centre of gravity (geometric centroid), measured along xp." + }, + "CentreOfGravityInY": { + "description": "Location of the profile's centre of gravity (geometric centroid), measured along yp." + }, + "CrossSectionArea": { + "description": "Area of the profile. For example measured in mm2. If given, the value of the cross section area shall be greater than zero." + }, + "MassPerLength": { + "description": "Mass per length, i.e. mass of a beam with a unit length of extrusion. For example measured in kg/m." + }, + "MaximumPlateThickness": { + "description": "This value may be needed for stress analysis and to handle buckling problems. It can also be derived from the given profile geometry or classification and therefore it is only an optional feature allowing for an explicit description. For example measured in mm." + }, + "MaximumSectionModulusY": { + "description": "Bending resistance about the ys axis at the point with maximum zs ordinate. For example measured in mm\u00b3." + }, + "MaximumSectionModulusZ": { + "description": "Bending resistance about the zs axis at the point with maximum ys ordinate. For example measured in mm\u00b3." + }, + "MinimumPlateThickness": { + "description": "This value may be needed for stress analysis and to handle buckling problems. It can also be derived from the given profile geometry or classification and therefore it is only an optional feature allowing for an explicit description. For example measured in mm." + }, + "MinimumSectionModulusY": { + "description": "Bending resistance about the ys axis at the point with minimum zs ordinate. For example measured in mm\u00b3." + }, + "MinimumSectionModulusZ": { + "description": "Bending resistance about the zs axis at the point with minimum ys ordinate. For example measured in mm\u00b3." + }, + "MomentOfInertiaY": { + "description": "Moment of inertia about ys (second moment of area, about ys). For example measured in mm4." + }, + "MomentOfInertiaYZ": { + "description": "Moment of inertia about ys and zs (product moment of area). For example measured in mm4." + }, + "MomentOfInertiaZ": { + "description": "Moment of inertia about zs (second moment of area, about zs). For example measured in mm4" + }, + "Perimeter": { + "description": "Perimeter of the profile for calculating the surface area. For example measured in mm." + }, + "PlasticShapeFactorY": { + "description": "Ratio of plastic versus elastic bending moment capacity about the section analysis axis ys. A dimensionless value." + }, + "PlasticShapeFactorZ": { + "description": "Ratio of plastic versus elastic bending moment capacity about the section analysis axis zs. A dimensionless value." + }, + "ShearAreaY": { + "description": "Area of the profile for calculating the shear stress due to shear force parallel to the section analysis axis ys. For example measured in mm\u00b2. If given, the shear area ys shall be non-negative." + }, + "ShearAreaZ": { + "description": "Area of the profile for calculating the shear stress due to shear force parallel to the section analysis axis zs. For example measured in mm\u00b2. If given, the shear area zs shall be non-negative." + }, + "ShearCentreY": { + "description": "Location of the profile's shear centre, measured along ys." + }, + "ShearCentreZ": { + "description": "Location of the profile's shear centre, measured along zs." + }, + "ShearDeformationAreaY": { + "description": "Area of the profile for calculating the shear deformation due to a shear force parallel to ys. For example measured in mm\u00b2. If given, the shear deformation area ys shall be non-negative." + }, + "ShearDeformationAreaZ": { + "description": "Area of the profile for calculating the shear deformation due to a shear force parallel to zs. For example measured in mm\u00b2. If given, the shear deformation area zs shall be non-negative." + }, + "TorsionalConstantX": { + "description": "Torsional constant about xs. For example measured in mm4." + }, + "TorsionalSectionModulus": { + "description": "Torsional resistance (about xs). For example measured in mm\u00b3." + }, + "WarpingConstant": { + "description": "Warping constant of the profile for torsional action. For example measured in mm6." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprofileresource/pset/pset_profilemechanical.htm" + }, + "Pset_ProjectOrderChangeOrder": { + "properties": { + "BudgetSource": { + "description": "The budget source requested." + }, + "ReasonForChange": { + "description": "A description of the problem for why a change is needed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_projectorderchangeorder.htm" + }, + "Pset_ProjectOrderMaintenanceWorkOrder": { + "properties": { + "ContractualType": { + "description": "The contractual type of the work." + }, + "FaultPriorityType": { + "description": "Identifies the predefined types of priority that can be assigned from which the type may be set where:" + }, + "IfNotAccomplished": { + "description": "Comments if the job is not accomplished." + }, + "LocationPriorityType": { + "description": "Identifies the predefined types of priority that can be assigned from which the type may be set where:" + }, + "MaintenaceType": { + "description": "Identifies the predefined types of maintenance that can be done from which the type that generates the maintenance work order may be set where:" + }, + "ProductDescription": { + "description": "A textual description of the products that require the work." + }, + "ScheduledFrequency": { + "description": "The period of time between expected instantiations of a work order that may have been predefined." + }, + "WorkTypeRequested": { + "description": "Work type requested in circumstances where there are categorizations of types of work task. It could be used to identify a remedial task, minor work task, electrical task etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_projectordermaintenanceworkorder.htm" + }, + "Pset_ProjectOrderMoveOrder": { + "properties": { + "SpecialInstructions": { + "description": "Special instructions that affect the move." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_projectordermoveorder.htm" + }, + "Pset_ProjectOrderPurchaseOrder": { + "properties": { + "IsFOB": { + "description": "Indication of whether contents of the purchase order are delivered 'Free on Board' (= True) or not (= False). FOB is a shipping term which indicates that the supplier pays the shipping costs (and usually also the insurance costs) from the point of manufacture to a specified destination, at which point the buyer takes responsibility." + }, + "ShipMethod": { + "description": "Method of shipping that will be used for goods or services." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_projectorderpurchaseorder.htm" + }, + "Pset_ProjectOrderWorkOrder": { + "properties": { + "ContractualType": { + "description": "The contractual type of the work." + }, + "IfNotAccomplished": { + "description": "Comments if the job is not accomplished." + }, + "ProductDescription": { + "description": "A textual description of the products that require the work." + }, + "WorkTypeRequested": { + "description": "Work type requested in circumstances where there are categorizations of types of work task. It could be used to identify a remedial task, minor work task, electrical task etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedmgmtelements/pset/pset_projectorderworkorder.htm" + }, + "Pset_PropertyAgreement": { + "properties": { + "AgreementType": { + "description": "Identifies the predefined types of property agreement from which the type required may be set." + }, + "CommencementDate": { + "description": "Date on which the agreement commences." + }, + "ConditionCommencement": { + "description": "Condition of property provided on commencement of the agreement e.g. cold shell, warm lit shell, broom clean, turn-key." + }, + "ConditionTermination": { + "description": "Condition of property required on termination of the agreement e.g. cold shell, warm lit shell, broom clean, turn-key." + }, + "Duration": { + "description": "The period of time for the lease." + }, + "Identifier": { + "description": "The identifier assigned to the agreement for the purposes of tracking." + }, + "Options": { + "description": "A statement of the options available in the agreement." + }, + "PropertyName": { + "description": "Addressing details of the property as stated within the agreement." + }, + "Restrictions": { + "description": "Restrictions that may be placed by a competent authority." + }, + "TerminationDate": { + "description": "Date on which the agreement terminates." + }, + "Version": { + "description": "The version number of the agreement that is identified." + }, + "VersionDate": { + "description": "The date on which the version of the agreement became applicable." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_propertyagreement.htm" + }, + "Pset_ProtectiveDeviceBreakerUnitI2TCurve": { + "properties": { + "BreakerUnitCurve": { + "description": "A curve that establishes the let through energy of a breaker unit when a particular prospective current is applied. Note that the breaker unit curve is defined within a Cartesian coordinate system and this fact must be asserted within the property set:" + }, + "NominalCurrent": { + "description": "A set of nominal currents in [A] for which the data of this instance is valid. At least one value shall be provided. Any value in the set shall not exceed the value of the UltimateRatedCurrent associated with the same breaker unit." + }, + "VoltageLevel": { + "description": "The voltage levels of the protective device for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicebreakeruniti2tcurve.htm" + }, + "Pset_ProtectiveDeviceBreakerUnitI2TFuseCurve": { + "properties": { + "BreakerUnitFuseBreakingingCurve": { + "description": "A curve that establishes the let through breaking energy of a breaker unit when a particular prospective breaking current is applied. Note that the breaker unit fuse breaking curve is defined within a Cartesian coordinate system and this fact must be:" + }, + "BreakerUnitFuseMeltingCurve": { + "description": "A curve that establishes the energy required to melt the fuse of a breaker unit when a particular prospective melting current is applied. Note that the breaker unit fuse melting curve is defined within a Cartesian coordinate system and this fact must be:" + }, + "VoltageLevel": { + "description": "The voltage levels of the fuse for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicebreakeruniti2tfusecurve.htm" + }, + "Pset_ProtectiveDeviceBreakerUnitIPICurve": { + "properties": { + "BreakerUnitIPICurve": { + "description": "A curve that establishes the let through peak current of a breaker unit when a particular prospective current is applied. Note that the breaker unit IPI curve is defined within a Cartesian coordinate system and this fact must be asserted within the property set:" + }, + "NominalCurrent": { + "description": "A set of nominal currents in [A] for which the data of this instance is valid. At least one value shall be provided. Any value in the set shall not exceed the value of the UltimateRatedCurrent associated with the same breaker unit." + }, + "VoltageLevel": { + "description": "The voltage level of the protective device for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicebreakerunitipicurve.htm" + }, + "Pset_ProtectiveDeviceBreakerUnitTypeMCB": { + "properties": { + "ICN60898": { + "description": "The nominal breaking capacity in [A] for an MCB tested in accordance with the IEC 60898 series." + }, + "ICS60898": { + "description": "The service breaking capacity in [A] for an MCB tested in accordance with the IEC 60898 series." + }, + "ICS60947": { + "description": "The service breaking capacity in [A] for an MCB tested in accordance with the IEC 60947 series." + }, + "ICU60947": { + "description": "The ultimate breaking capacity in [A] for an MCB tested in accordance with the IEC 60947 series." + }, + "NominalCurrents": { + "description": "A set of nominal currents in [A] for which the data of this instance is valid. At least one value shall be provided. Any value in the set shall not exceed the value of the UltimateRatedCurrent associated with the same breaker unit." + }, + "PowerLoss": { + "description": "The power loss in [W] per pole of the MCB when the nominal current is flowing through the MCB." + }, + "VoltageLevel": { + "description": "The voltage levels for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicebreakerunittypemcb.htm" + }, + "Pset_ProtectiveDeviceBreakerUnitTypeMotorProtection": { + "properties": { + "ICM60947": { + "description": "The making capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICS60947": { + "description": "The service breaking capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICU60947": { + "description": "The ultimate breaking capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICW60947": { + "description": "The thermal withstand current in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series. The value shall be related to 1 s." + }, + "PerformanceClasses": { + "description": "A set of designations of performance classes for the breaker unit for which the data of this instance is valid. A breaker unit being a motor protection device may be constructed for different levels of breaking capacities. A maximum of 7 different performance classes may be provided. Examples of performance classes that may be specified include B, C, N, S, H, L, V." + }, + "VoltageLevel": { + "description": "The voltage levels for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicebreakerunittypemotorprotection.htm" + }, + "Pset_ProtectiveDeviceOccurrence": { + "properties": { + "GroundFaultCurrentSetValue": { + "description": "Ground fault current set value. The set value of the ground tripping current if adjustable." + }, + "GroundFaultFunction": { + "description": "Applying ground fault function. A flag indicating that the ground fault function of the device is used. The value should be set to FALSE for devices not having a ground fault function, or if the ground fault function is not selected to be used." + }, + "GroundFaultTrippingTime": { + "description": "Ground fault tripping time. The set value of the ground fault tripping current if adjustable." + }, + "GroundFaulti2tFunction": { + "description": "Applying ground fault i2t function. A flag indicating that the I2t ground fault function of the device is used. The value should be set to TRUE only if the I2t function is explicitly selected for the device." + }, + "InstantaneousCurrentSetValue": { + "description": "Instantaneous current set value. The set value of the instantaneous tripping current if adjustable." + }, + "InstantaneousTrippingTime": { + "description": "Instantaneous tripping time. The set value of the instantaneous tripping time if adjustable." + }, + "LongTimeCurrentSetValue": { + "description": "Long time current set value. The set value of the long time tripping current if adjustable." + }, + "LongTimeDelay": { + "description": "Long time delay. The set value of the long time time-delay if adjustable." + }, + "LongTimeFunction": { + "description": "Applying long time function A flag indicating that the long time function (i.e. the thermal tripping) of the device is used. The value should be set to TRUE for all devices except those that allows the Long time function of the device not to be used." + }, + "PoleUsage": { + "description": "Pole usage." + }, + "ShortTimeCurrentSetValue": { + "description": "Short time current set value. The set value of the long time tripping current if adjustable." + }, + "ShortTimeFunction": { + "description": "Applying short time function A flag indicating that the short time function of the device is used. The value should be set to FALSE for devices not having a short time function, or if the short time function is not selected to be used." + }, + "ShortTimeTrippingTime": { + "description": "Short time tripping time. The set value of the short time tripping time if adjustable." + }, + "ShortTimei2tFunction": { + "description": "Applying short time i2t function. A flag indicating that the I2t short time function of the device is used. The value should be set to TRUE only if the I2t function is explicitly selected for the device." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedeviceoccurrence.htm" + }, + "Pset_ProtectiveDeviceTrippingCurve": { + "properties": { + "TrippingCurve": { + "description": "A curve that establishes the release time of a tripping unit when a particular prospective current is applied. Note that the tripping curve is defined within a Cartesian coordinate system and this fact must be asserted within the property set: " + }, + "TrippingCurveType": { + "description": "The type of tripping curve that is represented by the property set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingcurve.htm" + }, + "Pset_ProtectiveDeviceTrippingFunctionGCurve": { + "properties": { + "CurrentTolerance1": { + "description": "The tolerance for the current of time/current-curve in [%]." + }, + "CurrentTolerance2": { + "description": "The tolerance for the current of time/current-curve in [%] valid for times above CurrentTolereanceLimit1." + }, + "CurrentToleranceLimit1": { + "description": "The time limit in [s] limiting the application of CurrentTolerance1, if any. If the value is set to 0, the value of the CurrentTolerance1 is valid for the whole time/current-curve." + }, + "ExternalAdjusted": { + "description": "An indication if the ground fault protection may be adjusted according to an external current coil or not." + }, + "IsCurrentTolerancePositiveOnly": { + "description": "Indication whether the value of CurrentTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "IsSelectable": { + "description": "Indication whether the S-function can be switched off or not." + }, + "IsTimeTolerancePositiveOnly": { + "description": "Indication whether the value of TimeTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "NominalCurrentAdjusted": { + "description": "An indication if the tripping currents of the short time protection is related to the nominal current multiplied with the actual setting of the current adjustment, if any, of the long time protection part of the protective device, or not." + }, + "ReleaseCurrent": { + "description": "The release current in [x In] for the initial tripping of the S-function." + }, + "ReleaseCurrentI2tEnd": { + "description": "The release current in [x In] for the end point of the I2t tripping curve of the G-function, if any. The value of ReleaseCurrentI2tEnd shall be larger than ReleaseCurrentI2tStart." + }, + "ReleaseCurrentI2tStart": { + "description": "The release current in [x In] for the start point of the I2t tripping curve of the G-function, if any." + }, + "ReleaseTime": { + "description": "The release time in [s] for the initial tripping of the relevant part. This time indicates that for current lower than the indicated release current, the tripping time will be longer than the indicated release time. The value is given as a mean value." + }, + "ReleaseTimeI2tEnd": { + "description": "The release time in [s] for the end point of the I2 tripping curve of the G-function, if any. The value of ReleaseTimeI2tEnd shall be lower than ReleaseTimeI2tStart." + }, + "ReleaseTimeI2tStart": { + "description": "The release time in [s] for the start point of the I2t tripping curve of the G-function, if any." + }, + "TimeTolerance1": { + "description": "The tolerance for the time of time/current-curve in [%]." + }, + "TimeTolerance2": { + "description": "The tolerance for the time of the time/current-curve in [%] valid for currents above TimeToleranceLimit1." + }, + "TimeToleranceLimit1": { + "description": "The current limit in [x In] limiting the application of TimeTolerance1, if any. If the value is set to 0, the value of the TimeTolerance1 is valid for the whole time/current-curve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingfunctiongcurve.htm" + }, + "Pset_ProtectiveDeviceTrippingFunctionICurve": { + "properties": { + "CurrentTolerance1": { + "description": "The tolerance for the current of time/current-curve in [%]." + }, + "CurrentTolerance2": { + "description": "The tolerance for the current of time/current-curve in [%] valid for times above CurrentTolereanceLimit1." + }, + "CurrentToleranceLimit1": { + "description": "The time limit in [s] limiting the application of CurrentTolerance1, if any. If the value is set to 0, the value of the CurrentTolerance1 is valid for the whole time/current-curve." + }, + "IsCurrentTolerancePositiveOnly": { + "description": "Indication whether the value of CurrentTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "IsOffWhenSFunctionOn": { + "description": "Indication whether the I-function is automatically switched off when the S-function is switched on." + }, + "IsSelectable": { + "description": "Indication whether the S-function can be switched off or not." + }, + "IsTimeTolerancePositiveOnly": { + "description": "Indication whether the value of TimeTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "MaxAdjustmentX_ICS": { + "description": "Provides the maximum setting value for the available current adjustment in relation to the Ics breaking capacity of the protection device of which the actual tripping unit is a part of. The value is not asserted unless the instantaneous time protection is." + }, + "NominalCurrentAdjusted": { + "description": "An indication if the tripping currents of the short time protection is related to the nominal current multiplied with the actual setting of the current adjustment, if any, of the long time protection part of the protective device, or not." + }, + "ReleaseCurrent": { + "description": "The release current in [x In] for the initial tripping of the S-function." + }, + "ReleaseTime": { + "description": "The release time in [s] for the initial tripping of the relevant part. This time indicates that for current lower than the indicated release current, the tripping time will be longer than the indicated release time. The value is given as a mean value." + }, + "TimeTolerance1": { + "description": "The tolerance for the time of time/current-curve in [%]." + }, + "TimeTolerance2": { + "description": "The tolerance for the time of the time/current-curve in [%] valid for currents above TimeToleranceLimit1." + }, + "TimeToleranceLimit1": { + "description": "The current limit in [x In] limiting the application of TimeTolerance1, if any. If the value is set to 0, the value of the TimeTolerance1 is valid for the whole time/current-curve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingfunctionicurve.htm" + }, + "Pset_ProtectiveDeviceTrippingFunctionLCurve": { + "properties": { + "IsSelectable": { + "description": "Indication whether the L-function can be switched off or not." + }, + "LowerCurrent1": { + "description": "The current in [x In], indicating that for currents smaller than LowerCurrent1 the I2t part of the L-function will not trip the current," + }, + "LowerCurrent2": { + "description": "The current in [x In], indicating the upper current limit of the lower time/current curve of the I2t part of the L-function." + }, + "LowerTime1": { + "description": "The time in [s], indicating that tripping times of the lower time/current curve lower than LowerTime1 is determined by the I2t part of the L-function." + }, + "LowerTime2": { + "description": "The time in [s], indicating the tripping times of the upper time/current curve at the LowerCurrent2." + }, + "UpperCurrent1": { + "description": "The current in [x In], indicating that for currents larger than UpperCurrent1 the I2t part of the L-function will trip the current." + }, + "UpperCurrent2": { + "description": "The current in [x In], indicating the upper current limit of the upper time/current curve of the I2t part of the L-function." + }, + "UpperTime1": { + "description": "The time in [s], indicating that tripping times of the upper time/current curve lower than UpperTime1 is determined by the I2t part of the L-function." + }, + "UpperTime2": { + "description": "The time in [s], indicating the tripping times of the upper time/current curve at the UpperCurrent2." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingfunctionlcurve.htm" + }, + "Pset_ProtectiveDeviceTrippingFunctionSCurve": { + "properties": { + "CurrentTolerance1": { + "description": "The tolerance for the current of time/current-curve in [%]." + }, + "CurrentTolerance2": { + "description": "The tolerance for the current of time/current-curve in [%] valid for times above CurrentTolereanceLimit1." + }, + "CurrentToleranceLimit1": { + "description": "The time limit in [s] limiting the application of CurrentTolerance1, if any. If the value is set to 0, the value of the CurrentTolerance1 is valid for the whole time/current-curve." + }, + "IsCurrentTolerancePositiveOnly": { + "description": "Indication whether the value of CurrentTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "IsOffWhenLfunctionOn": { + "description": "Indication whether the S-function is automatically switched off when the I-function is switched on." + }, + "IsSelectable": { + "description": "Indication whether the S-function can be switched off or not." + }, + "IsTimeTolerancePositiveOnly": { + "description": "Indication whether the value of TimeTolerance1 is provided as a positive tolereance only or not. If not, the value is proved as a pluss/minus tolerance." + }, + "NominalCurrentAdjusted": { + "description": "An indication if the tripping currents of the short time protection is related to the nominal current multiplied with the actual setting of the current adjustment, if any, of the long time protection part of the protective device, or not." + }, + "ReleaseCurrent": { + "description": "The release current in [x In] for the initial tripping of the S-function." + }, + "ReleaseCurrentI2tEnd": { + "description": "The release current in [x In] for the end point of the I2t tripping curve of the S-function, if any. The value of ReleaseCurrentI2tEnd shall be larger than ReleaseCurrentI2tStart." + }, + "ReleaseCurrentI2tStart": { + "description": "The release current in [x In] for the start point of the I2t tripping curve of the S-function, if any." + }, + "ReleaseTime": { + "description": "The release time in [s] for the initial tripping of the relevant part. This time indicates that for current lower than the indicated release current, the tripping time will be longer than the indicated release time. The value is given as a mean value." + }, + "ReleaseTimeI2tEnd": { + "description": "The release time in [s] for the end point of the I2 tripping curve of the S-function, if any. The value of ReleaseTimeI2tEnd shall be lower than ReleaseTimeI2tStart." + }, + "ReleaseTimeI2tStart": { + "description": "The release time in [s] for the start point of the I2t tripping curve of the S-function, if any" + }, + "TimeTolerance1": { + "description": "The tolerance for the time of time/current-curve in [%]." + }, + "TimeTolerance2": { + "description": "The tolerance for the time of the time/current-curve in [%] valid for currents above TimeToleranceLimit1." + }, + "TimeToleranceLimit1": { + "description": "The current limit in [x In] limiting the application of TimeTolerance1, if any. If the value is set to 0, the value of the TimeTolerance1 is valid for the whole time/current-curve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingfunctionscurve.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitCurrentAdjustment": { + "properties": { + "AdjustmentDesignation": { + "description": "The desgnation on the device for the adjustment." + }, + "AdjustmentRange": { + "description": "Upper and lower current adjustment limits for an AdjustmentValueType = RANGE. Note that this property should not have a value for an AdjustmentValueType = LIST." + }, + "AdjustmentRangeStepValue": { + "description": "Step value of current adjustment for an AdjustmentValueType = RANGE. Note that this property should not have a value for an AdjustmentValueType = LIST." + }, + "AdjustmentValueType": { + "description": "The type of adjustment value that is applied through the property set. This determines the properties that should be asserted (see below)." + }, + "AdjustmentValues": { + "description": "A list of current adjustment values that may be applied to a tripping unit for an AdjustmentValueType = LIST. A minimum of 1 and a maximum of 16 adjustment values may be specified. Note that this property should not have a value for an AdjustmentValueType = RANGE." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunitcurrentadjustment.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTimeAdjustment": { + "properties": { + "AdjustmentDesignation": { + "description": "The desgnation on the device for the adjustment." + }, + "AdjustmentRange": { + "description": "Upper and lower time adjustment limits for an AdjustmentValueType = RANGE. Note that this property should not have a value for an AdjustmentValueType = LIST." + }, + "AdjustmentRangeStepValue": { + "description": "Step value of time adjustment for an AdjustmentValueType = RANGE. Note that this property should not have a value for an AdjustmentValueType = LIST." + }, + "AdjustmentValueType": { + "description": "The type of adjustment value that is applied through the property set. This determines the properties that should be asserted (see below)." + }, + "AdjustmentValues": { + "description": "A list of time adjustment values that may be applied to a tripping unit for an AdjustmentValueType = LIST. A minimum of 1 and a maximum of 16 adjustment values may be specified. Note that this property should not have a value for an AdjustmentValueType = RANGE." + }, + "CurrentForTimeDelay": { + "description": "The tripping current in [x In] at which the time delay is specified. A value for this property should only be asserted for time delay of L-function, and for I2t of the S and G function." + }, + "I2TApplicability": { + "description": "The applicability of the time adjustment related to the tripping function." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittimeadjustment.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTypeCommon": { + "properties": { + "AtexVerified": { + "description": "An indication whether the tripping_unit is verified to be applied in EX-environment or not." + }, + "LimitingTerminalSize": { + "description": "The maximum terminal size capacity of the device." + }, + "OldDevice": { + "description": "Indication whether the protection_ unit is out-dated or not. If not out-dated, the device is still for sale." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Standard": { + "description": "The designation of the standard applicable for the definition of the characteristics of the tripping_unit." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "UseInDiscrimination": { + "description": "An indication whether the time/current tripping information can be applied in a discrimination analysis or not." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittypecommon.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTypeElectroMagnetic": { + "properties": { + "CurveDesignation": { + "description": "The designation of the trippingcurve given by the manufacturer. For a MCB the designation should be in accordance with the designations given in IEC 60898." + }, + "DefinedTemperature": { + "description": "The ambient temperature at which the thermal current/time-curve associated with this protection device is defined." + }, + "ElectroMagneticTrippingUnitType": { + "description": "A list of the available types of electric magnetic tripping unit from which that required may be selected. These cover overload, none special, short circuit, motor protection and bi-metal tripping." + }, + "I1": { + "description": "The (thermal) lower testing current limit in [x In], indicating that for currents lower than I1, the tripping time shall be longer than the associated tripping time, T2." + }, + "I2": { + "description": "The (thermal) upper testing current limit in [x In], indicating that for currents larger than I2, the tripping time shall be shorter than the associated tripping time, T2." + }, + "I4": { + "description": "The lower electromagnetic testing current limit in [x In], indicating that for currents lower than I4, the tripping time shall be longer than the associated tripping time, T5, i.e. the device shall not trip instantaneous." + }, + "I5": { + "description": "The upper electromagnetic testing current limit in [x In], indicating that for currents larger than I5, the tripping time shall be shorter than or equal to the associated tripping time, T5, i.e. the device shall trip instantaneous." + }, + "T2": { + "description": "The (thermal) testing time in [s] associated with the testing currents I1 and I2." + }, + "T5": { + "description": "The electromagnetic testing time in [s] associated with the testing currents I4 and I5, i.e. electromagnetic tripping time" + }, + "TemperatureFactor": { + "description": "The correction factor (typically measured as %/deg K) for adjusting the thermal current/time to an ambient temperature different from the value given by the defined temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittypeelectromagnetic.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTypeElectronic": { + "properties": { + "ElectronicTrippingUnitType": { + "description": "A list of the available types of electronic tripping unit from which that required may be selected." + }, + "N_Protection": { + "description": "An indication whether the electronic tripping unit has separate protection for the N conductor, or not." + }, + "N_Protection_100": { + "description": "An indication whether the electronic tripping unit is tripping if the current in the N conductor is more than 100% of that of the phase conductors. The property is only asserted if the property N_Protection is asserted." + }, + "N_Protection_50": { + "description": "An indication whether the electronic tripping unit is tripping if the current in the N conductor is more than 50% of that of the phase conductors. The property is only asserted if the property N_Protection is asserted." + }, + "N_Protection_Select": { + "description": "An indication whether the use of the N_Protection can be selected by the user or not. If both the properties N_Protection_50 and N_Protection_100 are asserted, the value of N_Protection_Select property is set to TRUE. The property is only asserted if the property N_Protection is asserted." + }, + "NominalCurrents": { + "description": "A set of values providing information on available modules (chips) for setting the nominal current of the protective device. If the set is empty, no nominal current modules are available for the tripping unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittypeelectronic.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTypeResidualCurrent": { + "properties": { + "TrippingUnitReleaseCurrent": { + "description": "The value of tripping or residual current for which the device has the possibility to be equipped. The values are given in mA." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittyperesidualcurrent.htm" + }, + "Pset_ProtectiveDeviceTrippingUnitTypeThermal": { + "properties": { + "CurveDesignation": { + "description": "The designation of the trippingcurve given by the manufacturer. For a MCB the designation should be in accordance with the designations given in IEC 60898." + }, + "DefinedTemperature": { + "description": "The ambient temperature at which the thermal current/time-curve associated with this protection device is defined." + }, + "I1": { + "description": "The (thermal) lower testing current limit in [x In], indicating that for currents lower than I1, the tripping time shall be longer than the associated tripping time, T2." + }, + "I2": { + "description": "The (thermal) upper testing current limit in [x In], indicating that for currents larger than I2, the tripping time shall be shorter than the associated tripping time, T2." + }, + "T2": { + "description": "The (thermal) testing time in [s] associated with the testing currents I1 and I2." + }, + "TemperatureFactor": { + "description": "The correction factor (typically measured as %/deg K) for adjusting the thermal current/time to an ambient temperature different from the value given by the defined temperature." + }, + "ThermalTrippingUnitType": { + "description": "A list of the available types of thermal tripping unit from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetrippingunittypethermal.htm" + }, + "Pset_ProtectiveDeviceTypeCircuitBreaker": { + "properties": { + "ICM60947": { + "description": "The making capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICS60947": { + "description": "The service breaking capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICU60947": { + "description": "The ultimate breaking capacity in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series." + }, + "ICW60947": { + "description": "The thermal withstand current in [A] for a circuit breaker or motor protection device tested in accordance with the IEC 60947 series. The value shall be related to 1 s." + }, + "PerformanceClasses": { + "description": "A set of designations of performance classes for the breaker unit for which the data of this instance is valid. A breaker unit being a circuit breaker may be constructed for different levels of breaking capacities. A maximum of 7 different performance classes may be provided. Examples of performance classes that may be specified include B, C, N, S, H, L, V." + }, + "VoltageLevel": { + "description": "The voltage levels for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetypecircuitbreaker.htm" + }, + "Pset_ProtectiveDeviceTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetypecommon.htm" + }, + "Pset_ProtectiveDeviceTypeEarthLeakageCircuitBreaker": { + "properties": { + "EarthFailureDeviceType": { + "description": "A list of the available types of circuit breaker from which that required may be selected where:" + }, + "Sensitivity": { + "description": "The rated rms value of the vector sum of the instantaneous currents flowing in the main circuits of the device which causes the device to operate under specified conditions. (IEC 61008-1)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetypeearthleakagecircuitbreaker.htm" + }, + "Pset_ProtectiveDeviceTypeFuseDisconnector": { + "properties": { + "FuseDisconnectorType": { + "description": "A list of the available types of fuse disconnector from which that required may be selected where:" + }, + "IC60269": { + "description": "The breaking capacity in [A] for fuses in accordance with the IEC 60269 series." + }, + "PowerLoss": { + "description": "The power loss in [W] of the fuse when the nominal current is flowing through the fuse." + }, + "VoltageLevel": { + "description": "The voltage levels for which the data of the instance is valid. More than one value may be selected in the enumeration." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetypefusedisconnector.htm" + }, + "Pset_ProtectiveDeviceTypeResidualCurrentCircuitBreaker": { + "properties": { + "Sensitivity": { + "description": "Current leakage to an unwanted leading path during normal operation (IEC 151-14-49)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetyperesidualcurrentcircuitbreaker.htm" + }, + "Pset_ProtectiveDeviceTypeResidualCurrentSwitch": { + "properties": { + "Sensitivity": { + "description": "Current leakage to an unwanted leading path during normal operation (IEC 151-14-49)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetyperesidualcurrentswitch.htm" + }, + "Pset_ProtectiveDeviceTypeVaristor": { + "properties": { + "VaristorType": { + "description": "A list of the available types of varistor from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_protectivedevicetypevaristor.htm" + }, + "Pset_PumpOccurrence": { + "properties": { + "BaseType": { + "description": "Defines general types of pump bases." + }, + "DriveConnectionType": { + "description": "The way the pump drive mechanism is connected to the pump." + }, + "ImpellerDiameter": { + "description": "Diameter of pump impeller - used to scale performance of geometrically similar pumps." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pumpoccurrence.htm" + }, + "Pset_PumpPHistory": { + "properties": { + "Flowrate": { + "description": "The actual operational fluid flowrate." + }, + "MechanicalEfficiency": { + "description": "The pumps operational mechanical efficiency." + }, + "OverallEfficiency": { + "description": "The pump and motor overall operational efficiency." + }, + "Power": { + "description": "The actual power consumption of the pump." + }, + "PressureRise": { + "description": "The developed pressure." + }, + "RotationSpeed": { + "description": "Pump rotational speed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pumpphistory.htm" + }, + "Pset_PumpTypeCommon": { + "properties": { + "ConnectionSize": { + "description": "The connection size of the to and from the pump." + }, + "FlowRateRange": { + "description": "Allowable range of volume of fluid being pumped against the resistance specified." + }, + "FlowResistanceRange": { + "description": "Allowable range of frictional resistance against which the fluid is being pumped." + }, + "NetPositiveSuctionHead": { + "description": "Minimum liquid pressure at the pump inlet to prevent cavitation." + }, + "NominalRotationSpeed": { + "description": "Pump rotational speed under nominal conditions." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureRange": { + "description": "Allowable operational range of the fluid temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_pumptypecommon.htm" + }, + "Pset_RailingCommon": { + "properties": { + "Diameter": { + "description": "Diameter of the object. It is the diameter of the handrail of the railing. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence. Here the diameter of the hand or guardrail within the railing." + }, + "Height": { + "description": "Height of the object. It is the upper hight of the railing above the floor or stair. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_railingcommon.htm" + }, + "Pset_RampCommon": { + "properties": { + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here it defines an exit ramp in accordance to the national building code." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "HandicapAccessible": { + "description": "Indication that this object is designed to be accessible by the handicapped. Set to (TRUE) if this ramp is rated as handicap accessible according the local building codes, otherwise (FALSE)." + }, + "HasNonSkidSurface": { + "description": "Indication whether the surface finish is designed to prevent slippery (TRUE) or not (FALSE)." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": {}, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "RequiredHeadroom": { + "description": "Required headroom clearance for the passageway according to the applicable building code or additional requirements." + }, + "RequiredSlope": { + "description": "Required sloping angle of the object - relative to horizontal (0.0 degrees). Required maximum slope for the passageway according to the applicable building code or additional requirements." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_rampcommon.htm" + }, + "Pset_RampFlightCommon": { + "properties": { + "ClearWidth": { + "description": "Actual clear width measured as the clear space for accessibility and egress; it is a measured distance betwen the two handrails or the wall and a handrail on a ramp. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "CounterSlope": { + "description": "Sloping angle of the object, measured perpendicular to the slope - relative to horizontal (0.0 degrees). Actual maximum slope for the passageway measured perpendicular to the direction of travel according to the current design. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence. Note: new property in IFC4." + }, + "Headroom": { + "description": "Actual headroom clearance for the passageway according to the current design. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Slope": { + "description": "Sloping angle of the object - relative to horizontal (0.0 degrees). Actual maximum slope for the passageway according to the current design. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_rampflightcommon.htm" + }, + "Pset_ReinforcementBarCountOfIndependentFooting": { + "properties": { + "Description": { + "description": "Description of the reinforcement." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + }, + "XDirectionLowerBarCount": { + "description": "The number of bars with X direction lower bar." + }, + "XDirectionUpperBarCount": { + "description": "The number of bars with X direction upper bar." + }, + "YDirectionLowerBarCount": { + "description": "The number of bars with Y direction lower bar." + }, + "YDirectionUpperBarCount": { + "description": "The number of bars with Y direction upper bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarcountofindependentfooting.htm" + }, + "Pset_ReinforcementBarPitchOfBeam": { + "properties": { + "Description": { + "description": "Description of the reinforcement." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + }, + "SpacingBarPitch": { + "description": "The pitch length of the spacing bar." + }, + "StirrupBarPitch": { + "description": "The pitch length of the stirrup bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarpitchofbeam.htm" + }, + "Pset_ReinforcementBarPitchOfColumn": { + "properties": { + "Description": { + "description": "Description of the reinforcement." + }, + "HoopBarPitch": { + "description": "The pitch length of the hoop bar." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + }, + "ReinforcementBarType": { + "description": "Defines the type of the reinforcement bar." + }, + "XDirectionTieHoopBarPitch": { + "description": "The X direction pitch length of the tie hoop." + }, + "XDirectionTieHoopCount": { + "description": "The number of bars with X direction tie hoop bars." + }, + "YDirectionTieHoopBarPitch": { + "description": "The Y direction pitch length of the tie hoop." + }, + "YDirectionTieHoopCount": { + "description": "The number of bars with Y direction tie hoop bars." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarpitchofcolumn.htm" + }, + "Pset_ReinforcementBarPitchOfContinuousFooting": { + "properties": { + "CrossingLowerBarPitch": { + "description": "The pitch length of the crossing lower bar." + }, + "CrossingUpperBarPitch": { + "description": "The pitch length of the crossing upper bar." + }, + "Description": { + "description": "Description of the reinforcement." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarpitchofcontinuousfooting.htm" + }, + "Pset_ReinforcementBarPitchOfSlab": { + "properties": { + "Description": { + "description": "Description of the reinforcement." + }, + "LongInsideCenterLowerBarPitch": { + "description": "The pitch length of the long inside center lower bar." + }, + "LongInsideCenterTopBarPitch": { + "description": "The pitch length of the long inside center top bar." + }, + "LongInsideEndLowerBarPitch": { + "description": "The pitch length of the long inside end lower bar." + }, + "LongInsideEndTopBarPitch": { + "description": "The pitch length of the long inside end top bar." + }, + "LongOutsideLowerBarPitch": { + "description": "The pitch length of the long outside lower bar." + }, + "LongOutsideTopBarPitch": { + "description": "The pitch length of the long outside top bar." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + }, + "ShortInsideCenterLowerBarPitch": { + "description": "The pitch length of the short inside center lower bar." + }, + "ShortInsideCenterTopBarPitch": { + "description": "The pitch length of the short inside center top bar." + }, + "ShortInsideEndLowerBarPitch": { + "description": "The pitch length of the short inside end lower bar." + }, + "ShortInsideEndTopBarPitch": { + "description": "The pitch length of the short inside end top bar." + }, + "ShortOutsideLowerBarPitch": { + "description": "The pitch length of the short outside lower bar." + }, + "ShortOutsideTopBarPitch": { + "description": "The pitch length of the short outside top bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarpitchofslab.htm" + }, + "Pset_ReinforcementBarPitchOfWall": { + "properties": { + "BarAllocationType": { + "description": "Defines the type of the reinforcement bar allocation." + }, + "Description": { + "description": "Description of the reinforcement." + }, + "HorizontalBarPitch": { + "description": "The pitch length of the horizontal bar." + }, + "Reference": { + "description": "A descriptive label for the general reinforcement type." + }, + "SpacingBarPitch": { + "description": "The pitch length of the spacing bar." + }, + "VerticalBarPitch": { + "description": "The pitch length of the vertical bar." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcementbarpitchofwall.htm" + }, + "Pset_ReinforcingBarCommon": { + "properties": { + "BarLength": { + "description": "The total length of the reinforcing bar. The total length of bended bars are calculated according to local standards with corrections for the bends." + }, + "BarSpacing": { + "description": "The spacing between bars if constant." + }, + "BarSurface": { + "description": "Indicator for whether the bar surface is plain or textured." + }, + "BendingParameters": { + "description": "If this mesh type is bent rather than planar, this attribute provides bending shape parameters. Their meaning is defined by the bending shape code and the respective standard." + }, + "BendingShapeCode": { + "description": "Shape code per a standard like ACI 315, ISO 3766, or a similar standard. It is presumed that a single standard for defining the bar bending is used throughout the project and that this standard is referenced from the IfcProject object through the IfcDocumentReference mechanism." + }, + "NominalDiameter": { + "description": "The nominal diameter defining the cross-section size of the reinforcing bar." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcingbarcommon.htm" + }, + "Pset_ReinforcingMeshCommon": { + "properties": { + "LongitudinalBarNominalDiameter": {}, + "LongitudinalBarSpacing": {}, + "LongitudinalBarSurface": { + "description": "Indicator for whether the bar surface is plain or textured." + }, + "MeshLength": {}, + "MeshWidth": {}, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TransverseBarBendingParameters": { + "description": "If this mesh type is bent rather than planar, this attribute provides bending shape parameters. Their meaning is defined by the bending shape code and the respective standard." + }, + "TransverseBarBendingShapeCode": { + "description": "Shape code per a standard like ACI 315, ISO 3766, or a similar standard. It is presumed that a single standard for defining the bar bending is used throughout the project and that this standard is referenced from the IfcProject object through the IfcDocumentReference mechanism." + }, + "TransverseBarNominalDiameter": {}, + "TransverseBarSpacing": {}, + "TransverseBarSurface": { + "description": "Indicator for whether the bar surface is plain or textured." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_reinforcingmeshcommon.htm" + }, + "Pset_Risk": { + "properties": { + "AffectsSurroundings": { + "description": "Indicates wether the risk affects only to the person assigned to that task (FALSE) or if it can also affect to the people in the surroundings (TRUE)." + }, + "AssessmentOfRisk": { + "description": "Likelihood of risk event occurring." + }, + "NatureOfRisk": { + "description": "An indication of the generic nature of the risk that might be encountered. " + }, + "PreventiveMeassures": { + "description": "Identifies preventive measures to be taken to mitigate risk." + }, + "RiskCause": { + "description": "A value that may be assigned to capture the cause or trigger for the risk. An example might be 'poor fixing'." + }, + "RiskConsequence": { + "description": "Indicates the level of severity of the consequences that the risk would have in case it happens." + }, + "RiskOwner": { + "description": "A determination of who is the owner of the risk by reference to principal roles of organizations within a project. Determination of the specific organization should be by reference to instances of IfcActorRole assigned to instances of IfcOrganization (if assigned)." + }, + "RiskRating": { + "description": "A general rating of the risk that may be determined from a combination of the risk assessment and risk consequence." + }, + "RiskType": { + "description": "Identifies the predefined types of risk from which the type required may be set." + }, + "SubNatureOfRisk1": { + "description": "A first subsidiary value that might be assigned to designate a more specific type of risk." + }, + "SubNatureOfRisk2": { + "description": "A second subsidiary value that might be assigned to designate a more specific type of risk. An example might be 'o person and property'." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_risk.htm" + }, + "Pset_RoofCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": {}, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Here the total thermal transmittance coefficient through the roof surface (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_roofcommon.htm" + }, + "Pset_SanitaryTerminalTypeBath": { + "properties": { + "BathType": { + "description": "The property enumeration defines the types of bath that may be specified within the property set." + }, + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "HasGrabHandles": { + "description": "Indicates whether the bath is fitted with handles that provide assistance to a bather in entering or leaving the bath." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypebath.htm" + }, + "Pset_SanitaryTerminalTypeBidet": { + "properties": { + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "Mounting": { + "description": "The property enumeration Pset_SanitaryMountingEnum defines the forms of mounting or fixing of the sanitary terminal that may be specified within property sets used to define sanitary terminals (WC\u2019s, basins, sinks, etc.) where:-" + }, + "SpilloverLevel": { + "description": "The level at which water spills out of the object." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypebidet.htm" + }, + "Pset_SanitaryTerminalTypeCistern": { + "properties": { + "CisternCapacity": { + "description": "Volumetric capacity of the cistern" + }, + "CisternHeight": { + "description": "Enumeration that identifies the height of the cistern or, if set to 'None' if the urinal has no cistern and is flushed using mains or high pressure water through a flushing valve." + }, + "FlushRate": { + "description": "The minimum and maximum volume of water used at each flush. Where a single flush is used, the value of upper bound and lower bound should be equal. For a dual flush toilet, the lower bound should be used for the lesser flush rate and the upper bound for the greater flush rate. Where flush is achieved using mains pressure water through a flush valve, the value of upper and lower bound should be equal and should be the same as the flush rate property of the flush valve (see relevant valve property set). Alternatively, in this case, do not assert the flush rate property; refer to the flush rate of the flush valve." + }, + "FlushType": { + "description": "The property enumeration Pset_FlushTypeEnum defines the types of flushing mechanism that may be specified for cisterns and sanitary terminals where:-" + }, + "IsAutomaticFlush": { + "description": "Boolean value that determines if the cistern is flushed automatically either after each use or periodically (TRUE) or whether manual flushing is required (FALSE)." + }, + "IsSingleFlush": { + "description": "Indicates whether the cistern is single flush = TRUE (i.e. the same amount of water is used for each and every flush) or dual flush = FALSE (i.e. the amount of water used for a flush may be selected by the user to be high or low depending on the waste material to be removed)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypecistern.htm" + }, + "Pset_SanitaryTerminalTypeCommon": { + "properties": { + "Color": { + "description": "Color selection for this object." + }, + "NominalDepth": { + "description": "Nominal or quoted depth of the object." + }, + "NominalLength": { + "description": "Nominal or quoted length of the object." + }, + "NominalWidth": { + "description": "Nominal or quoted width of the object." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypecommon.htm" + }, + "Pset_SanitaryTerminalTypeSanitaryFountain": { + "properties": { + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "FountainType": { + "description": "Selection of the type of fountain from the enumerated list of types where:-" + }, + "Mounting": { + "description": "Selection of the form of mounting of the fountain from the enumerated list of mountings where:-" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypesanitaryfountain.htm" + }, + "Pset_SanitaryTerminalTypeShower": { + "properties": { + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "HasTray": { + "description": "Indicates whether the shower has a separate receptacle that catches the water in a shower and directs it to a waste outlet." + }, + "ShowerHeadDescription": { + "description": "A description of the shower head(s) that emit the spray of water." + }, + "ShowerType": { + "description": "Selection of the type of shower from the enumerated list of types where:-" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypeshower.htm" + }, + "Pset_SanitaryTerminalTypeSink": { + "properties": { + "Color": { + "description": "Color selection for this object." + }, + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "Mounting": { + "description": "Selection of the form of mounting of the sink from the enumerated list of mountings where:-" + }, + "MountingOffset": { + "description": "For cunter top maounted sinks, the vertical offset between the top of the sink and the counter top." + }, + "SinkType": { + "description": "Selection of the type of sink from the enumerated list of types where:-" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypesink.htm" + }, + "Pset_SanitaryTerminalTypeToiletPan": { + "properties": { + "PanMounting": { + "description": "The property enumeration Pset_SanitaryMountingEnum defines the forms of mounting or fixing of the sanitary terminal that may be specified within property sets used to define sanitary terminals (WC\u2019s, basins, sinks, etc.) where:-" + }, + "SpilloverLevel": { + "description": "The level at which water spills out of the terminal." + }, + "ToiletPanType": { + "description": "The property enumeration Pset_ToiletPanTypeEnum defines the types of toilet pan that may be specified within the property set Pset_Toilet:-" + }, + "ToiletType": { + "description": "Enumeration that defines the types of toilet (water closet) arrangements that may be specified where:-" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypetoiletpan.htm" + }, + "Pset_SanitaryTerminalTypeUrinal": { + "properties": { + "Mounting": { + "description": "Selection of the form of mounting from the enumerated list of mountings where:-" + }, + "SpilloverLevel": { + "description": "The level at which water spills out of the object." + }, + "UrinalType": { + "description": "Selection of the type of urinal from the enumerated list of types where:-" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypeurinal.htm" + }, + "Pset_SanitaryTerminalTypeWashHandBasin": { + "properties": { + "DrainSize": { + "description": "The size of the drain outlet connection from the object." + }, + "Mounting": { + "description": "Selection of the form of mounting from the enumerated list of mountings where:-" + }, + "MountingOffset": { + "description": "For counter top mounted basins the vertical offset between the top of the sink and the counter top." + }, + "WashHandBasinType": { + "description": "Defines the types of wash hand basin that may be specified where:" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_sanitaryterminaltypewashhandbasin.htm" + }, + "Pset_SensorPHistory": { + "properties": { + "Direction": { + "description": "Indicates sensed direction for sensors capturing magnitude and direction measured from True North (0 degrees) in a clockwise direction." + }, + "Quality": { + "description": "Indicates the quality of measurement or failure condition, which may be further qualified by the Status. True: measured values are considered reliable; False: measured values are considered not reliable (i.e. a fault has been detected); Unknown: reliability of values is uncertain." + }, + "Status": { + "description": "Indicates an error code or identifier, whose meaning is specific to the particular automation system. Example values include: 'ConfigurationError', 'NotConnected', 'DeviceFailure', 'SensorFailure', 'LastKnown, 'CommunicationsFailure', 'OutOfService'." + }, + "Value": { + "description": "Indicates sensed values over time which may be recorded continuously or only when changed beyond a particular deadband. The range of possible values is defined by the SetPoint property of the corresponding sensor type property set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensorphistory.htm" + }, + "Pset_SensorTypeCO2Sensor": { + "properties": { + "SetPointConcentration": { + "description": "The carbon dioxide concentration to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeco2sensor.htm" + }, + "Pset_SensorTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypecommon.htm" + }, + "Pset_SensorTypeConductanceSensor": { + "properties": { + "SetPointConductance": { + "description": "The fill level value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeconductancesensor.htm" + }, + "Pset_SensorTypeContactSensor": { + "properties": { + "SetPointContact": { + "description": "The contact value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypecontactsensor.htm" + }, + "Pset_SensorTypeFireSensor": { + "properties": { + "AccuracyOfFireSensor": { + "description": "The accuracy of the sensor." + }, + "FireSensorSetPoint": { + "description": "The temperature value to be sensed to indicate the presence of fire." + }, + "TimeConstant": { + "description": "The time constant of the sensor." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypefiresensor.htm" + }, + "Pset_SensorTypeFlowSensor": { + "properties": { + "SetPointFlow": { + "description": "The volumetric flow value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeflowsensor.htm" + }, + "Pset_SensorTypeFrostSensor": { + "properties": { + "SetPointFrost": { + "description": "The detection of frost." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypefrostsensor.htm" + }, + "Pset_SensorTypeGasSensor": { + "properties": { + "CoverageArea": { + "description": "The floor area that is covered by the sensor (typically measured as a circle whose center is at the location of the sensor)." + }, + "GasDetected": { + "description": "Identification of the gas that is being detected, according to chemical formula. For example, carbon monoxide is 'CO', carbon dioxide is 'CO2', oxygen is 'O2'." + }, + "SetPointConcentration": { + "description": "The gas concentration value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypegassensor.htm" + }, + "Pset_SensorTypeHeatSensor": { + "properties": { + "CoverageArea": { + "description": "The area that is covered by the sensor (typically measured as a circle whose center is at the location of the sensor)." + }, + "RateOfTemperatureRise": { + "description": "The rate of temperature rise that is to be sensed as being hazardous." + }, + "SetPointTemperature": { + "description": "The temperature value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeheatsensor.htm" + }, + "Pset_SensorTypeHumiditySensor": { + "properties": { + "SetPointHumidity": { + "description": "The humidity value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypehumiditysensor.htm" + }, + "Pset_SensorTypeIdentifierSensor": { + "properties": { + "SetPointIdentifier": { + "description": "The detected tag value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeidentifiersensor.htm" + }, + "Pset_SensorTypeIonConcentrationSensor": { + "properties": { + "SetPointConcentration": { + "description": "The ion concentration value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + }, + "SubstanceDetected": { + "description": "Identification of the substance that is being detected according to chemical formula. For example, calcium carbonate is 'CaCO3'" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypeionconcentrationsensor.htm" + }, + "Pset_SensorTypeLevelSensor": { + "properties": { + "SetPointLevel": { + "description": "The fill level value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypelevelsensor.htm" + }, + "Pset_SensorTypeLightSensor": { + "properties": { + "SetPointIlluminance": { + "description": "The illuminance value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypelightsensor.htm" + }, + "Pset_SensorTypeMoistureSensor": { + "properties": { + "SetPointMoisture": { + "description": "The moisture value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypemoisturesensor.htm" + }, + "Pset_SensorTypeMovementSensor": { + "properties": { + "MovementSensingType": { + "description": "Enumeration that identifies the type of movement sensing mechanism." + }, + "SetPointMovement": { + "description": "The movement to be sensed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypemovementsensor.htm" + }, + "Pset_SensorTypePHSensor": { + "properties": { + "SetPointPH": { + "description": "The fill level value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypephsensor.htm" + }, + "Pset_SensorTypePressureSensor": { + "properties": { + "IsSwitch": { + "description": "Identifies if the sensor also functions as a switch at the set point (=TRUE) or not (= FALSE)." + }, + "SetPointPressure": { + "description": "The pressure value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypepressuresensor.htm" + }, + "Pset_SensorTypeRadiationSensor": { + "properties": { + "SetPointRadiation": { + "description": "The radiation power value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortyperadiationsensor.htm" + }, + "Pset_SensorTypeRadioactivitySensor": { + "properties": { + "SetPointRadioactivity": { + "description": "The radioactivity value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortyperadioactivitysensor.htm" + }, + "Pset_SensorTypeSmokeSensor": { + "properties": { + "CoverageArea": { + "description": "The floor area that is covered by the sensor (typically measured as a circle whose center is at the location of the sensor)." + }, + "HasBuiltInAlarm": { + "description": "Indicates whether the smoke sensor is included as an element within a smoke alarm/sensor unit (TRUE) or not (FALSE)." + }, + "SetPointConcentration": { + "description": "The smoke concentration value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypesmokesensor.htm" + }, + "Pset_SensorTypeSoundSensor": { + "properties": { + "SetPointSound": { + "description": "The sound pressure value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypesoundsensor.htm" + }, + "Pset_SensorTypeTemperatureSensor": { + "properties": { + "SetPointTemperature": { + "description": "The temperature value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + }, + "TemperatureSensorType": { + "description": "Enumeration that Identifies the types of temperature sensor that can be specified." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypetemperaturesensor.htm" + }, + "Pset_SensorTypeWindSensor": { + "properties": { + "SetPointSpeed": { + "description": "The wind speed value to be sensed. Use IfcPropertyBoundedValue.SetPointValue to set the set point value." + }, + "WindSensorType": { + "description": "Enumeration that Identifies the types of wind sensors that can be specified." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_sensortypewindsensor.htm" + }, + "Pset_ServiceLife": { + "properties": { + "MeanTimeBetweenFailure": { + "description": "The average time duration between instances of failure of a product." + }, + "ServiceLifeDuration": { + "description": "The length or duration of a service life. " + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_servicelife.htm" + }, + "Pset_ServiceLifeFactors": { + "properties": { + "DesignLevel": { + "description": "Adjustment of the service life resulting from the effect of design level employed." + }, + "InUseConditions": { + "description": "Adjustment of the service life resulting from the effect of the conditions in which components are operating." + }, + "IndoorEnvironment": { + "description": "Adjustment of the service life resulting from the effect of the indoor environment (where appropriate)." + }, + "MaintenanceLevel": { + "description": "Adjustment of the service life resulting from the effect of the level or degree of maintenance applied to dcomponents." + }, + "OutdoorEnvironment": { + "description": "Adjustment of the service life resulting from the effect of the outdoor environment (where appropriate)" + }, + "QualityOfComponents": { + "description": "Adjustment of the service life resulting from the effect of the quality of components used." + }, + "WorkExecutionLevel": { + "description": "Adjustment of the service life resulting from the effect of the quality of work executed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_servicelifefactors.htm" + }, + "Pset_ShadingDeviceCommon": { + "properties": { + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "MechanicalOperated": { + "description": "Indication whether the element is operated machanically (TRUE) or not, i.e. manually (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Roughness": { + "description": "A measure of the vertical deviations of the surface." + }, + "ShadingDeviceType": { + "description": "Specifies the type of shading device." + }, + "SolarReflectance": { + "description": "(Rsol): The ratio of incident solar radiation that is reflected by a shading system (also named \u03c1e). Note the following equation Asol + Rsol + Tsol = 1" + }, + "SolarTransmittance": { + "description": "(Tsol): The ratio of incident solar radiation that directly passes through a shading system (also named \u03c4e). Note the following equation Asol + Rsol + Tsol = 1" + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SurfaceColor": { + "description": "The color of the surface." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material of a certain thickness for this element." + }, + "VisibleLightReflectance": { + "description": "Fraction of the visible light that is reflected by the glazing at normal incidence. It is a value without unit." + }, + "VisibleLightTransmittance": { + "description": "Fraction of the visible light that passes the shading system at normal incidence. It is a value without unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_shadingdevicecommon.htm" + }, + "Pset_ShadingDevicePHistory": { + "properties": { + "Azimuth": { + "description": "The azimuth of the outward normal for the outward or upward facing surface." + }, + "TiltAngle": { + "description": "The angle of tilt defined in the plane perpendicular to the extrusion axis (X-Axis of the local placement). The angle shall be measured from the orientation of the Z-Axis in the local placement." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_shadingdevicephistory.htm" + }, + "Pset_SiteCommon": { + "properties": { + "BuildableArea": { + "description": "The area of site utilization expressed as a maximum value according to local building codes." + }, + "BuildingHeightLimit": { + "description": "Allowed maximum height of buildings on this site - according to local building codes." + }, + "FloorAreaRatio": { + "description": "The ratio of all floor areas to the buildable area as the maximum floor area utilization of the site as a maximum value according to local building codes." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal project type." + }, + "SiteCoverageRatio": { + "description": "The ratio of the utilization, TotalArea / BuildableArea, expressed as a maximum value. The ratio value may be used to derive BuildableArea." + }, + "TotalArea": { + "description": "Total planned area for the site. Used for programming the site space." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_sitecommon.htm" + }, + "Pset_SlabCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "Combustible": { + "description": "Indication whether the object is made from combustible material (TRUE) or not (FALSE)." + }, + "Compartmentation": { + "description": "Indication whether the object is designed to serve as a fire compartmentation (TRUE) or not (FALSE)." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "PitchAngle": { + "description": "Angle of the slab to the horizontal when used as a component for the roof (specified as 0 degrees or not asserted for cases where the slab is not used as a roof component). " + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SurfaceSpreadOfFlame": { + "description": "Indication on how the flames spread around the surface, It is given according to the national building code that governs the fire behaviour for materials." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Here the total thermal transmittance coefficient through the slab (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_slabcommon.htm" + }, + "Pset_SolarDeviceTypeCommon": { + "properties": { + "ActiveCellSurfaceAreaFraction": { + "description": "The percentage of surface area containing active solar cells. Note: the surface area may be provided at Qto_SolarDeviceBaseQuantities.GrossArea." + }, + "CellEfficiency": { + "description": "The ratio of power generated divided by incident solar power." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_solardevicetypecommon.htm" + }, + "Pset_SoundAttenuation": { + "properties": { + "SoundFrequency": { + "description": "List of nominal sound frequencies, correlated to the SoundPressure time series values (IfcTimeSeries.ListValues)" + }, + "SoundPressure": { + "description": "A time series of sound pressure values measured in decibels at a reference pressure of 20 microPascals for the referenced octave band frequency. Each value in IfcTimeSeries.ListValues is correlated to the sound frequency at the same position within SoundFrequencies." + }, + "SoundScale": { + "description": "The reference sound scale. " + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_soundattenuation.htm" + }, + "Pset_SoundGeneration": { + "properties": { + "SoundCurve": { + "description": "Table of sound frequencies and sound power measured in decibels at a reference power of 1 picowatt(10\\^(-12) watt) for the referenced octave band frequency." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_soundgeneration.htm" + }, + "Pset_SpaceCommon": { + "properties": { + "GrossPlannedArea": { + "description": "Total planned gross area for the space. Used for programming the space." + }, + "HandicapAccessible": { + "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as an accessible space for handicapped people, e.g., for a public toilet (TRUE) or not (FALSE). This information is often used to declare the need for access for the disabled and for special design requirements of this space." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "NetPlannedArea": { + "description": "Total planned net area for the space. Used for programming the space." + }, + "PubliclyAccessible": { + "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as a publicly accessible space, e.g., for a public toilet (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal project type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spacecommon.htm" + }, + "Pset_SpaceCoveringRequirements": { + "properties": { + "CeilingCovering": { + "description": "Label to indicate the material or finish of the space flooring. The label is used for room book information and often displayed in room stamp." + }, + "CeilingCoveringThickness": { + "description": "Thickness of the material layer(s) for the space ceiling. " + }, + "ConcealedCeiling": { + "description": "Indication whether this space is designed to have a concealed flooring space (TRUE) or not (FALSE). A concealed ceiling space is normally meant to be the space between a slab and a ceiling." + }, + "ConcealedCeilingOffset": { + "description": "Distance between the upper floor slab and the suspended ceiling, often used for distribution systems. Often referred to as plenum." + }, + "ConcealedFlooring": { + "description": "Indication whether this space is designed to have a concealed flooring space (TRUE) or not (FALSE). A concealed flooring space is normally meant to be the space beneath a raised floor." + }, + "ConcealedFlooringOffset": { + "description": "Distance between the floor slab and the floor covering, often used for cables and other installations. Often referred to as raised flooring." + }, + "FloorCovering": { + "description": "Label to indicate the material or finish of the space flooring. The label is used for room book information and often displayed in room stamp." + }, + "FloorCoveringThickness": { + "description": "Thickness of the material layer(s) for the space flooring. " + }, + "Molding": { + "description": "Label to indicate the material or construction of the molding around the space ceiling. The label is used for room book information." + }, + "MoldingHeight": { + "description": "Height of the molding." + }, + "SkirtingBoard": { + "description": "Label to indicate the material or construction of the skirting board around the space flooring. The label is used for room book information." + }, + "SkirtingBoardHeight": { + "description": "Height of the skirting board." + }, + "WallCovering": { + "description": "Label to indicate the material or finish of the space flooring. The label is used for room book information and often displayed in room stamp." + }, + "WallCoveringThickness": { + "description": "Thickness of the material layer(s) for the space cladding. " + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spacecoveringrequirements.htm" + }, + "Pset_SpaceFireSafetyRequirements": { + "properties": { + "AirPressurization": { + "description": "Indication whether the space is required to have pressurized air (TRUE) or not (FALSE)." + }, + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here whether the space (in case of e.g., a corridor) is designed to serve as an exit space, e.g., for fire escape purposes." + }, + "FireRiskFactor": { + "description": "Fire Risk factor assigned to the space according to local building regulations. It defines the fire risk of the space at several levels of fire hazard." + }, + "FlammableStorage": { + "description": "Indication whether the space is intended to serve as a storage of flammable material (which is regarded as such by the presiding building code. (TRUE) indicates yes, (FALSE) otherwise." + }, + "SprinklerProtection": { + "description": "Indication whether the space is sprinkler protected (TRUE) or not (FALSE)." + }, + "SprinklerProtectionAutomatic": { + "description": "Indication whether the space has an automatic sprinkler protection (TRUE) or not (FALSE). It should only be given, if the property \"SprinklerProtection\" is set to TRUE." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spacefiresafetyrequirements.htm" + }, + "Pset_SpaceHeaterPHistory": { + "properties": { + "AirResistanceCurve": { + "description": "Air resistance curve (w/ fan only); Pressure = f ( flow rate)." + }, + "AuxiliaryEnergySourceConsumption": { + "description": "Auxiliary energy source consumption." + }, + "Effectiveness": { + "description": "Ratio of the real heat transfer rate to the maximum possible heat transfer rate." + }, + "Exponent": { + "description": "Characteristic exponent, slope of log(heat output) vs log (surface temperature minus environmental temperature)." + }, + "FractionConvectiveHeatTransfer": { + "description": "Fraction of the total heat transfer rate as the convective heat transfer." + }, + "FractionRadiantHeatTransfer": { + "description": "Fraction of the total heat transfer rate as the radiant heat transfer." + }, + "HeatOutputRate": { + "description": "Overall heat transfer rate." + }, + "OutputCapacityCurve": { + "description": "Partial output capacity curve (as a function of water temperature); Q = f (Twater)." + }, + "SpaceAirTemperature": { + "description": "Dry bulb temperature in the space." + }, + "SpaceMeanRadiantTemperature": { + "description": "Mean radiant temperature in the space." + }, + "SurfaceTemperature": { + "description": "Average surface temperature of the component." + }, + "UACurve": { + "description": "UA curve as function of ambient temperature and surface temperature; UA = f (Tambient, Tsurface)" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_spaceheaterphistory.htm" + }, + "Pset_SpaceHeaterTypeCommon": { + "properties": { + "BodyMass": { + "description": "Overall body mass of the heater." + }, + "EnergySource": { + "description": "Enumeration defining the energy source or fuel combusted to generate heat if applicable. Note: hydronic heaters shall use UNSET; dual-use hydronic/electric heaters shall use ELECTRICITY." + }, + "HeatTransferDimension": { + "description": "Indicates how heat is transmitted according to the shape of the space heater." + }, + "HeatTransferMedium": { + "description": "Enumeration defining the heat transfer medium if applicable." + }, + "NumberOfPanels": { + "description": "Number of panels." + }, + "NumberOfSections": { + "description": "Number of vertical sections, measured in the direction of flow." + }, + "OutputCapacity": { + "description": "Total nominal heat output as listed by the manufacturer." + }, + "PlacementType": { + "description": "Indicates how the space heater is designed to be placed." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TemperatureClassification": { + "description": "Enumeration defining the temperature classification of the space heater surface temperature. low temperature - surface temperature is relatively low, usually heated by hot water or electricity. high temperature - surface temperature is relatively high, usually heated by gas or steam." + }, + "ThermalEfficiency": { + "description": "Overall Thermal Efficiency is defined as gross energy output of the heat transfer device divided by the energy input." + }, + "ThermalMassHeatCapacity": { + "description": "Product of component mass and specific heat." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_spaceheatertypecommon.htm" + }, + "Pset_SpaceHeaterTypeConvector": { + "properties": { + "ConvectorType": { + "description": "Indicates the type of convector, whether forced air (mechanically driven) or natural (gravity)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_spaceheatertypeconvector.htm" + }, + "Pset_SpaceHeaterTypeRadiator": { + "properties": { + "RadiatorType": { + "description": "Indicates the type of radiator." + }, + "TubingLength": { + "description": "Water tube length inside the component." + }, + "WaterContent": { + "description": "Weight of water content within the heater." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_spaceheatertyperadiator.htm" + }, + "Pset_SpaceLightingRequirements": { + "properties": { + "ArtificialLighting": { + "description": "Indication whether this space requires artificial lighting (as natural lighting would be not sufficient). (TRUE) indicates yes (FALSE) otherwise." + }, + "Illuminance": { + "description": "Required average illuminance value for this space." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spacelightingrequirements.htm" + }, + "Pset_SpaceOccupancyRequirements": { + "properties": { + "AreaPerOccupant": { + "description": "Design occupancy loading for this type of usage assigned to this space." + }, + "IsOutlookDesirable": { + "description": "An indication of whether the outlook is desirable (set TRUE) or not (set FALSE)" + }, + "MinimumHeadroom": { + "description": "Headroom required for the activity assigned to this space." + }, + "OccupancyNumber": { + "description": "Number of people required for the activity assigned to this space." + }, + "OccupancyNumberPeak": { + "description": "Maximal number of people required for the activity assigned to this space in peak time." + }, + "OccupancyTimePerDay": { + "description": "The amount of time during the day that the activity is required within this space." + }, + "OccupancyType": { + "description": "Occupancy type for this object. It is defined according to the presiding national building code." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spaceoccupancyrequirements.htm" + }, + "Pset_SpaceParking": { + "properties": { + "IsAisle": { + "description": "Indicates that this parking zone is for accessing the parking units, i.e. an aisle (TRUE) and not a parking unit itself (FALSE)" + }, + "IsOneWay": { + "description": "Indicates whether the parking aisle is designed for oneway traffic (TRUE) or twoway traffic (FALSE). Should only be provided if the property IsAisle is set to TRUE." + }, + "ParkingUnits": { + "description": "Indicates the number of transporation units of the type specified by the property ParkingUse that may be accommodated within the space. Generally, this value should default to 1 unit. However, where the parking space is for motorcycles or bicycles, provision may be made for more than one unit in the space." + }, + "ParkingUse": { + "description": "Identifies the type of transporation for which the parking space is designed. Values are not predefined but might include car, compact car, motorcycle, bicycle, truck, bus etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spaceparking.htm" + }, + "Pset_SpaceThermalDesign": { + "properties": { + "BoundaryAreaHeatLoss": { + "description": "Heat loss per unit area for the boundary object. This is a design input value for use in the absence of calculated load data." + }, + "CeilingRAPlenum": { + "description": "Ceiling plenum used for return air or not. TRUE = Yes, FALSE = No." + }, + "CoolingDesignAirflow": { + "description": "The air flowrate required during the peak cooling conditions." + }, + "CoolingDryBulb": { + "description": "Inside dry bulb temperature for cooling design." + }, + "CoolingRelativeHumidity": { + "description": "Inside relative humidity for cooling design." + }, + "ExhaustAirFlowrate": { + "description": "Design exhaust air flow rate for the space." + }, + "HeatingDesignAirflow": { + "description": "The air flowrate required during the peak heating conditions, but could also be determined by minimum ventilation requirement or minimum air change requirements." + }, + "HeatingDryBulb": { + "description": "Inside dry bulb temperature for heating design." + }, + "HeatingRelativeHumidity": { + "description": "Inside relative humidity for heating design." + }, + "TotalHeatGain": { + "description": "The total amount of heat or energy gained by the space at the time of the space's peak cooling conditions." + }, + "TotalHeatLoss": { + "description": "The total amount of heat or energy lost by the space at the time of the space's peak heating conditions." + }, + "TotalSensibleHeatGain": { + "description": "The total sensible heat or energy gained by the space during the peak cooling conditions." + }, + "VentilationAirFlowrate": { + "description": "Ventilation outside air requirement for the space." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_spacethermaldesign.htm" + }, + "Pset_SpaceThermalLoad": { + "properties": { + "AirExchangeRate": { + "description": "Loads from the air exchange rate." + }, + "DryBulbTemperature": { + "description": "Loads from the dry bulb temperature." + }, + "EquipmentSensible": { + "description": "Heat gains and losses from equipment." + }, + "ExhaustAir": { + "description": "Loads from exhaust air." + }, + "InfiltrationSensible": { + "description": "Heat gains and losses from infiltration." + }, + "Lighting": { + "description": "Lighting loads." + }, + "People": { + "description": "Heat gains and losses from people." + }, + "RecirculatedAir": { + "description": "Loads from recirculated air." + }, + "RelativeHumidity": { + "description": "Loads from the relative humidity." + }, + "TotalLatentLoad": { + "description": "Total energy added or removed from air that affects its humidity or concentration of water vapor. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "TotalRadiantLoad": { + "description": "Total electromagnetic energy added or removed by emission or absorption. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "TotalSensibleLoad": { + "description": "Total energy added or removed from air that affects its temperature. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "VentilationIndoorAir": { + "description": "Ventilation loads from indoor air." + }, + "VentilationOutdoorAir": { + "description": "Ventilation loads from outdoor air." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_spacethermalload.htm" + }, + "Pset_SpaceThermalLoadPHistory": { + "properties": { + "AirExchangeRate": { + "description": "Loads from the air exchange rate." + }, + "DryBulbTemperature": { + "description": "Loads from the dry bulb temperature." + }, + "EquipmentSensible": { + "description": "Heat gains and losses from equipment." + }, + "ExhaustAir": { + "description": "Loads from exhaust air." + }, + "InfiltrationSensible": { + "description": "Heat gains and losses from infiltration." + }, + "Lighting": { + "description": "Lighting loads." + }, + "People": { + "description": "Heat gains and losses from people." + }, + "RecirculatedAir": { + "description": "Loads from recirculated air." + }, + "RelativeHumidity": { + "description": "Loads from the relative humidity." + }, + "TotalLatentLoad": { + "description": "Total energy added or removed from air that affects its humidity or concentration of water vapor. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "TotalRadiantLoad": { + "description": "Total electromagnetic energy added or removed by emission or absorption. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "TotalSensibleLoad": { + "description": "Total energy added or removed from air that affects its temperature. If a value is less than zero (negative), then the thermal load is lost from the space. If a value is greater than zero (positive), then the thermal load is a gain to the space." + }, + "VentilationIndoorAir": { + "description": "Ventilation loads from indoor air." + }, + "VentilationOutdoorAir": { + "description": "Ventilation loads from outdoor air." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_spacethermalloadphistory.htm" + }, + "Pset_SpaceThermalPHistory": { + "properties": { + "CoolingAirFlowRate": { + "description": "Cooling air flow rate in the space." + }, + "ExhaustAirFlowRate": { + "description": "Exhaust air flow rate in the space." + }, + "HeatingAirFlowRate": { + "description": "Heating air flow rate in the space." + }, + "SpaceRelativeHumidity": { + "description": "The relative humidity of the space." + }, + "SpaceTemperature": { + "description": "Temperature of the space." + }, + "VentilationAirFlowRate": { + "description": "Ventilation air flow rate in the space." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_spacethermalphistory.htm" + }, + "Pset_SpaceThermalRequirements": { + "properties": { + "AirConditioning": { + "description": "Indication whether this space requires air conditioning provided (TRUE) or not (FALSE)." + }, + "AirConditioningCentral": { + "description": "Indication whether the space requires a central air conditioning provided (TRUE) or not (FALSE). It should only be given, if the property \"AirConditioning\" is set to TRUE." + }, + "DiscontinuedHeating": { + "description": "Indication whether discontinued heating is required/desirable from user/designer view point. (TRUE) if yes, (FALSE) otherwise." + }, + "MechanicalVentilationRate": { + "description": "Indication of the requirement of a particular mechanical air ventilation rate, given in air changes per hour." + }, + "NaturalVentilation": { + "description": "Indication whether the space is required to have natural ventilation (TRUE) or mechanical ventilation (FALSE)." + }, + "NaturalVentilationRate": { + "description": "Indication of the requirement of a particular natural air ventilation rate, given in air changes per hour." + }, + "SpaceHumidity": { + "description": "Humidity of the space or zone that is required from user/designer view point. If no summer or winter space humidity requirements are given, it applies all year, otherwise for the intermediate period. Provide this property, if no humidity range (Min-Max) is available." + }, + "SpaceHumidityMax": { + "description": "Maximal permitted humidity of the space or zone that is required from user/designer view point. If no summer or winter space humidity requirements are given, it applies all year, otherwise for the intermediate period." + }, + "SpaceHumidityMin": { + "description": "Minimal permitted humidity of the space or zone that is required from user/designer view point. If no summer or winter space humidity requirements are given, it applies all year, otherwise for the intermediate period." + }, + "SpaceHumiditySummer": { + "description": "Humidity of the space or zone for the hot (summer) period, that is required from user/designer view point and provided as requirement for cooling." + }, + "SpaceHumidityWinter": { + "description": "Humidity of the space or zone for the cold (winter) period that is required from user/designer view point and provided as requirement for heating." + }, + "SpaceTemperature": { + "description": "Temperature of the space or zone, that is required from user/designer view point. If no summer or winter space temperature requirements are given, it applies all year, otherwise for the intermediate period. Provide this value, if no temperatur range (Min-Max) is available." + }, + "SpaceTemperatureMax": { + "description": "Maximal temperature of the space or zone, that is required from user/designer view point. If no summer or winter space temperature requirements are given, it applies all year, otherwise for the intermediate period." + }, + "SpaceTemperatureMin": { + "description": "Minimal temperature of the space or zone, that is required from user/designer view point. If no summer or winter space temperature requirements are given, it applies all year, otherwise for the intermediate period." + }, + "SpaceTemperatureSummerMax": { + "description": "Maximal temperature of the space or zone for the hot (summer) period, that is required from user/designer view point and provided as requirement for cooling." + }, + "SpaceTemperatureSummerMin": { + "description": "Minimal temperature of the space or zone for the hot (summer) period, that is required from user/designer view point and provided as requirement for cooling." + }, + "SpaceTemperatureWinterMax": { + "description": "Maximal temperature of the space or zone for the cold (winter) period, that is required from user/designer view point and provided as requirement for heating." + }, + "SpaceTemperatureWinterMin": { + "description": "Minimal temperature of the space or zone for the cold (winter) period, that is required from user/designer view point and provided as requirement for heating." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spacethermalrequirements.htm" + }, + "Pset_SpatialZoneCommon": { + "properties": { + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external zone at the outside of the building." + }, + "Reference": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_spatialzonecommon.htm" + }, + "Pset_StackTerminalTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_stackterminaltypecommon.htm" + }, + "Pset_StairCommon": { + "properties": { + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here it defines an exit stair in accordance to the national building code." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "HandicapAccessible": { + "description": "Indication that this object is designed to be accessible by the handicapped. Set to (TRUE) if this stair is rated as handicap accessible according the local building codes, otherwise (FALSE). Accessibility maybe provided by additional means." + }, + "HasNonSkidSurface": { + "description": "Indication whether the surface finish is designed to prevent slippery (TRUE) or not (FALSE)." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": {}, + "NosingLength": { + "description": "Horizontal distance from the front of the tread to the riser underneath. It is the overhang of the tread." + }, + "NumberOfRiser": { + "description": "Total number of the risers included in the stair." + }, + "NumberOfTreads": { + "description": "Total number of treads included in the stair." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "RequiredHeadroom": { + "description": "Required headroom clearance for the passageway according to the applicable building code or additional requirements." + }, + "RiserHeight": { + "description": "Vertical distance from tread to tread. The riser height is supposed to be equal for all steps of a stair or stair flight." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": {}, + "TreadLength": { + "description": "Horizontal distance from the front of the thread to the front of the next tread. The tread length is supposed to be equal for all steps of the stair or stair flight at the walking line." + }, + "TreadLengthAtInnerSide": { + "description": "Minimum length of treads at the inner side of the winder. Only relevant in case of winding flights, for straight flights it is identical with IfcStairFlight.TreadLength. It is a pre-calculated value, in case of inconsistencies, the value derived from the shape representation shall take precedence." + }, + "TreadLengthAtOffset": { + "description": "Length of treads at a given offset. Walking line position is given by the 'WalkingLineOffset'. The resulting value should normally be identical with TreadLength, it may be given in addition, if the walking line offset for building code calculations is different from that used in design." + }, + "WaistThickness": { + "description": "Minimum thickness of the stair flight, measured perpendicular to the slope of the flight to the inner corner of riser and tread. It is a pre-calculated value, in case of inconsistencies, the value derived from the shape representation shall take precedence." + }, + "WalkingLineOffset": { + "description": "Offset of the walking line from the inner side of the flight. Note: the walking line may have a own shape representation (in case of inconsistencies, the value derived from the shape representation shall take precedence)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_staircommon.htm" + }, + "Pset_StairFlightCommon": { + "properties": { + "Headroom": { + "description": "Actual headroom clearance for the passageway according to the current design. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "NosingLength": { + "description": "Horizontal distance from the front of the tread to the riser underneath. It is the overhang of the tread." + }, + "NumberOfRiser": { + "description": "Total number of the risers included in the stair flight." + }, + "NumberOfTreads": { + "description": "Total number of treads included in the stair flight." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "RiserHeight": { + "description": "Vertical distance from tread to tread. The riser height is supposed to be equal for all steps of a stair or stair flight." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TreadLength": { + "description": "Horizontal distance from the front of the thread to the front of the next tread. The tread length is supposed to be equal for all steps of the stair or stair flight at the walking line." + }, + "TreadLengthAtInnerSide": { + "description": "Minimum length of treads at the inner side of the winder. Only relevant in case of winding flights, for straight flights it is identical with IfcStairFlight.TreadLength. It is a pre-calculated value, in case of inconsistencies, the value derived from the shape representation shall take precedence." + }, + "TreadLengthAtOffset": { + "description": "Length of treads at a given offset. Walking line position is given by the 'WalkingLineOffset'. The resulting value should normally be identical with TreadLength, it may be given in addition, if the walking line offset for building code calculations is different from that used in design." + }, + "WaistThickness": { + "description": "Minimum thickness of the stair flight, measured perpendicular to the slope of the flight to the inner corner of riser and tread. It is a pre-calculated value, in case of inconsistencies, the value derived from the shape representation shall take precedence." + }, + "WalkingLineOffset": { + "description": "Offset of the walking line from the inner side of the flight. Note: the walking line may have a own shape representation (in case of inconsistencies, the value derived from the shape representation shall take precedence)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_stairflightcommon.htm" + }, + "Pset_StructuralSurfaceMemberVaryingThickness": { + "properties": { + "Location1Global": { + "description": "Global X,Y,Z coordinates of the point in which Thickness1 is given" + }, + "Location1Local": { + "description": "Local x,y coordinates of the point in which Thickness1 is given" + }, + "Location2Global": { + "description": "Global X,Y,Z coordinates of the point in which Thickness2 is given" + }, + "Location2Local": { + "description": "Local x,y coordinates of the point in which Thickness2 is given" + }, + "Location3Global": { + "description": "Global X,Y,Z coordinates of the point in which Thickness3 is given" + }, + "Location3Local": { + "description": "Local x,y coordinates of the point in which Thickness3 is given" + }, + "Thickness1": { + "description": "First thickness parameter of a surface member with varying thickness" + }, + "Thickness2": { + "description": "Second thickness parameter of a surface member with varying thickness" + }, + "Thickness3": { + "description": "Third thickness parameter of a surface member with varying thickness" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralanalysisdomain/pset/pset_structuralsurfacemembervaryingthickness.htm" + }, + "Pset_SwitchingDeviceTypeCommon": { + "properties": { + "HasLock": { + "description": "Indication of whether a switching device has a key operated lock (=TRUE) or not (= FALSE)." + }, + "IsIlluminated": { + "description": "An indication of whether there is an illuminated indicator to show that the switch is on (=TRUE) or not (= FALSE)." + }, + "Legend": { + "description": "A text inscribed or applied to the switch as a legend to indicate purpose or function." + }, + "NumberOfGangs": { + "description": "Number of gangs/buttons on this switch." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "SetPoint": { + "description": "Indicates the setpoint and label. For toggle switches, there are two positions, 0 for off and 1 for on. For dimmer switches, the values may indicate the fully-off and full-on positions, where missing integer values in between are interpolated. For selector switches, the range indicates the available positions. An IfcTable may be attached (using IfcMetric and IfcPropertyConstraintRelationship) containing columns of the specified header names and types: 'Position' (IfcInteger): The discrete setpoint level. 'Sink' (IfcLabel): The Name of the switched input port (IfcDistributionPort with FlowDirection=SINK). 'Source' (IfcLabel): The Name of the switched output port (IfcDistributionPort with FlowDirection=SOURCE). 'Ratio' (IfcNormalizedRatioMeasure): The ratio of power at the setpoint where 0.0 is off and 1.0 is fully on." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SwitchFunction": { + "description": "Indicates types of switches which differs in functionality." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypecommon.htm" + }, + "Pset_SwitchingDeviceTypeContactor": { + "properties": { + "ContactorType": { + "description": "A list of the available types of contactor from which that required may be selected where:" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypecontactor.htm" + }, + "Pset_SwitchingDeviceTypeDimmerSwitch": { + "properties": { + "DimmerType": { + "description": "A list of the available types of dimmer switch from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypedimmerswitch.htm" + }, + "Pset_SwitchingDeviceTypeEmergencyStop": { + "properties": { + "SwitchOperation": { + "description": "Indicates operation of emergency stop switch." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypeemergencystop.htm" + }, + "Pset_SwitchingDeviceTypeKeypad": { + "properties": { + "KeypadType": { + "description": "A list of the available types of keypad switch from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypekeypad.htm" + }, + "Pset_SwitchingDeviceTypeMomentarySwitch": { + "properties": { + "MomentaryType": { + "description": "A list of the available types of momentary switch from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypemomentaryswitch.htm" + }, + "Pset_SwitchingDeviceTypePHistory": { + "properties": { + "SetPoint": { + "description": "Indicates the switch position over time according to Pset_SwitchingDeviceTypeCommon.SetPoint." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypephistory.htm" + }, + "Pset_SwitchingDeviceTypeSelectorSwitch": { + "properties": { + "SelectorType": { + "description": "A list of the available types of selector switch from which that required may be selected." + }, + "SwitchActivation": { + "description": "A list of the available activations for selector switches from which that required may be selected." + }, + "SwitchUsage": { + "description": "A list of the available usages for selector switches from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypeselectorswitch.htm" + }, + "Pset_SwitchingDeviceTypeStarter": { + "properties": { + "StarterType": { + "description": "A list of the available types of starter from which that required may be selected where:" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypestarter.htm" + }, + "Pset_SwitchingDeviceTypeSwitchDisconnector": { + "properties": { + "LoadDisconnectionType": { + "description": "A list of the available types of load disconnection from which that required may be selected." + }, + "SwitchDisconnectorType": { + "description": "A list of the available types of switch disconnector from which that required may be selected where:" + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypeswitchdisconnector.htm" + }, + "Pset_SwitchingDeviceTypeToggleSwitch": { + "properties": { + "SwitchActivation": { + "description": "A list of the available activations for toggle switches from which that required may be selected." + }, + "SwitchUsage": { + "description": "A list of the available usages for toggle switches from which that required may be selected." + }, + "ToggleSwitchType": { + "description": "A list of the available types of toggle switch from which that required may be selected." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_switchingdevicetypetoggleswitch.htm" + }, + "Pset_SystemFurnitureElementTypeCommon": { + "properties": { + "Finishing": { + "description": "The finishing applied to system furniture elements of this type e.g. walnut, fabric." + }, + "GroupCode": { + "description": "e.g. panels, worksurfaces, storage, etc." + }, + "IsUsed": { + "description": "Indicates whether the element is being used in a workstation (= TRUE) or not.(= FALSE)." + }, + "NominalHeight": { + "description": "The nominal height of the system furniture elements of this type. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + }, + "NominalWidth": { + "description": "The nominal width of the system furniture elements of this type. The size information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the size properties, provided in the attached property set, the geometric parameters take precedence." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_systemfurnitureelementtypecommon.htm" + }, + "Pset_SystemFurnitureElementTypePanel": { + "properties": { + "FurniturePanelType": { + "description": "Available panel types from which that required may be selected." + }, + "HasOpening": { + "description": "indicates whether the panel has an opening (= TRUE) or not (= FALSE)." + }, + "NominalThickness": { + "description": "The nominal thickness of the panel." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_systemfurnitureelementtypepanel.htm" + }, + "Pset_SystemFurnitureElementTypeWorkSurface": { + "properties": { + "HangingHeight": { + "description": "The hanging height of the worksurface." + }, + "NominalThickness": { + "description": "The nominal thickness of the work surface." + }, + "ShapeDescription": { + "description": "A description of the shape of the work surface e.g. corner square, rectangle, etc." + }, + "SupportType": { + "description": "Available support types from which that required may be selected." + }, + "UsePurpose": { + "description": "The principal purpose for which the work surface is intended to be used e.g. writing/reading, computer, meeting, printer, reference files, etc." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_systemfurnitureelementtypeworksurface.htm" + }, + "Pset_TankOccurrence": { + "properties": { + "HasLadder": { + "description": "Indication of whether the tank is provided with a ladder (set TRUE) for access to the top. If no ladder is provided then value is set FALSE." + }, + "HasVisualIndicator": { + "description": "Indication of whether the tank is provided with a visual indicator (set TRUE) that shows the water level in the tank. If no visual indicator is provided then value is set FALSE." + }, + "TankComposition": { + "description": "Defines the level of element composition where." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tankoccurrence.htm" + }, + "Pset_TankPHistory": { + "properties": { + "Level": { + "description": "The level of the tank as a fraction of its available capacity." + }, + "Pressure": { + "description": "The pressure of the substance in the tank." + }, + "Temperature": { + "description": "The temperature of the substance in the tank." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tankphistory.htm" + }, + "Pset_TankTypeCommon": { + "properties": { + "AccessType": { + "description": "Defines the types of access (or cover) to a tank that may be specified." + }, + "EffectiveCapacity": { + "description": "The total effective or actual volumetric capacity of the tank." + }, + "EndShapeType": { + "description": "Defines the types of end shapes that can be used for preformed tanks. The convention for reading these enumerated values is that for a vertical cylinder, the first value is the base and the second is the top; for a horizontal cylinder, the order of reading should be left to right. For a speherical tank, the value UNSET should be used." + }, + "FirstCurvatureRadius": { + "description": "FirstCurvatureRadius should be defined as the base or left side radius of curvature value." + }, + "NominalCapacity": { + "description": "The total nominal or design volumetric capacity of the tank." + }, + "NominalDepth": { + "description": "The nominal depth of the tank." + }, + "NominalLengthOrDiameter": { + "description": "The nominal length or, in the case of a vertical cylindrical tank, the nominal diameter of the tank." + }, + "NominalWidthOrDiameter": { + "description": "The nominal width or, in the case of a horizontal cylindrical tank, the nominal diameter of the tank." + }, + "NumberOfSections": { + "description": "Number of sections used in the construction of the tank. Default is 1." + }, + "OperatingWeight": { + "description": "Operating weight of the tank including all of its contents." + }, + "PatternType": { + "description": "Defines the types of pattern (or shape of a tank that may be specified." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "SecondCurvatureRadius": { + "description": "SecondCurvatureRadius should be defined as the top or right side radius of curvature value." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "StorageType": { + "description": "Defines the general material category intended to be stored." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tanktypecommon.htm" + }, + "Pset_TankTypeExpansion": { + "properties": { + "ChargePressure": { + "description": "Nominal or design operating pressure of the tank." + }, + "PressureRegulatorSetting": { + "description": "Pressure that is automatically maintained in the tank." + }, + "ReliefValveSetting": { + "description": "Pressure at which the relief valve activates." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tanktypeexpansion.htm" + }, + "Pset_TankTypePreformed": { + "properties": { + "EndShapeType": { + "description": "Defines the types of end shapes that can be used for preformed tanks. The convention for reading these enumerated values is that for a vertical cylinder, the first value is the base and the second is the top; for a horizontal cylinder, the order of reading should be left to right. For a speherical tank, the value UNSET should be used." + }, + "FirstCurvatureRadius": { + "description": "FirstCurvatureRadius should be defined as the base or left side radius of curvature value." + }, + "PatternType": { + "description": "Defines the types of pattern (or shape of a tank that may be specified." + }, + "SecondCurvatureRadius": { + "description": "SecondCurvatureRadius should be defined as the top or right side radius of curvature value." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tanktypepreformed.htm" + }, + "Pset_TankTypePressureVessel": { + "properties": { + "ChargePressure": { + "description": "Nominal or design operating pressure of the tank." + }, + "PressureRegulatorSetting": { + "description": "Pressure that is automatically maintained in the tank." + }, + "ReliefValveSetting": { + "description": "Pressure at which the relief valve activates." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tanktypepressurevessel.htm" + }, + "Pset_TankTypeSectional": { + "properties": { + "NumberOfSections": { + "description": "Number of sections used in the construction of the tank" + }, + "SectionLength": { + "description": "The length of a section used in the construction of the tank." + }, + "SectionWidth": { + "description": "The width of a section used in the construction of the tank." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tanktypesectional.htm" + }, + "Pset_TendonAnchorCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_tendonanchorcommon.htm" + }, + "Pset_TendonCommon": { + "properties": { + "NominalDiameter": { + "description": "The nominal diameter defining the cross-section size of the prestressed part of the tendon." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "SheathDiameter": { + "description": "Diameter of the sheeth (duct) around the tendon, if there is one with this type of tendon." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/pset/pset_tendoncommon.htm" + }, + "Pset_ThermalLoadAggregate": { + "properties": { + "ApplianceDiversity": { + "description": "Diversity of appliance load." + }, + "InfiltrationDiversitySummer": { + "description": "Diversity factor for Summer infiltration." + }, + "InfiltrationDiversityWinter": { + "description": "Diversity factor for Winter infiltration." + }, + "LightingDiversity": { + "description": "Lighting diversity." + }, + "LoadSafetyFactor": { + "description": "Load safety factor." + }, + "TotalCoolingLoad": { + "description": "The peak total cooling load for the building, zone or space." + }, + "TotalHeatingLoad": { + "description": "The peak total heating load for the building, zone or space." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_thermalloadaggregate.htm" + }, + "Pset_ThermalLoadDesignCriteria": { + "properties": { + "AppliancePercentLoadToRadiant": { + "description": "Percent of sensible load to radiant heat." + }, + "LightingLoadIntensity": { + "description": "Average lighting load intensity in the space per unit area (PowerMeasure/IfcAreaMeasure)." + }, + "LightingPercentLoadToReturnAir": { + "description": "Percent of lighting load to the return air plenum." + }, + "OccupancyDiversity": { + "description": "Diversity factor that may be applied to the number of people in the space." + }, + "OutsideAirPerPerson": { + "description": "Design quantity of outside air to be provided per person in the space." + }, + "ReceptacleLoadIntensity": { + "description": "Average power use intensity of appliances and other non-HVAC equipment in the space per unit area.(PowerMeasure/IfcAreaMeasure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_thermalloaddesigncriteria.htm" + }, + "Pset_TransformerTypeCommon": { + "properties": { + "EfficiencyCurve": { + "description": "The ratio of power transformed according to fractional load, where the first value indicates the load percentage and the second value indicates the efficiency of power transformation." + }, + "ImaginaryImpedanceRatio": { + "description": "The ratio between the imaginary part of the zero sequence impedance and the imaginary part of the positive impedance (i.e. imaginary part of the short-circuit voltage) of the transformer. Used for three-phase transformer which includes a N-conductor." + }, + "IsNeutralPrimaryTerminalAvailable": { + "description": "An indication of whether the neutral point of the primary winding is available as a terminal (=TRUE) or not (= FALSE)." + }, + "IsNeutralSecondaryTerminalAvailable": { + "description": "An indication of whether the neutral point of the secondary winding is available as a terminal (=TRUE) or not (= FALSE)." + }, + "MaximumApparentPower": { + "description": "Maximum apparent power/capacity in VA (volt ampere)." + }, + "PrimaryApparentPower": { + "description": "The power in VA (volt ampere) that has been transformed and that runs into the transformer on the primary side." + }, + "PrimaryCurrent": { + "description": "The current that is going to be transformed and that runs into the transformer on the primary side." + }, + "PrimaryFrequency": { + "description": "The frequency that is going to be transformed and that runs into the transformer on the primary side." + }, + "PrimaryVoltage": { + "description": "The voltage that is going to be transformed and that runs into the transformer on the primary side." + }, + "RadiativeFraction": { + "description": "The fraction of energy converted to heat." + }, + "RealImpedanceRatio": { + "description": "The ratio between the real part of the zero sequence impedance and the real part of the positive impedance (i.e. real part of the short-circuit voltage) of the transformer. Used for three-phase transformer which includes a N-conductor." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "SecondaryApparentPower": { + "description": "The power in VA (volt ampere) that has been transformed and is running out of the transformer on the secondary side." + }, + "SecondaryCurrent": { + "description": "The current that has been transformed and is running out of the transformer on the secondary side." + }, + "SecondaryCurrentType": { + "description": "A list of the secondary current types that can result from transformer output." + }, + "SecondaryFrequency": { + "description": "The frequency that has been transformed and is running out of the transformer on the secondary side." + }, + "SecondaryVoltage": { + "description": "The voltage that has been transformed and is running out of the transformer on the secondary side." + }, + "ShortCircuitVoltage": { + "description": "A complex number that specifies the real and imaginary parts of the short-circuit voltage at rated current of a transformer given in %." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "TransformerVectorGroup": { + "description": "List of the possible vector groups for the transformer from which that required may be set. Values in the enumeration list follow a standard international code where the first letter describes how the primary windings are connected, the second letter describes how the secondary windings are connected, and the numbers describe the rotation of voltages and currents from the primary to the secondary side in multiples of 30 degrees." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/pset/pset_transformertypecommon.htm" + }, + "Pset_TransportElementCommon": { + "properties": { + "CapacityPeople": { + "description": "Capacity of the transportation element measured in numbers of person." + }, + "CapacityWeight": { + "description": "Capacity of the transport element measured by weight." + }, + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here whether the transport element (in case of e.g., a lift) is designed to serve as a fire exit, e.g., for fire escape purposes." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal construction type." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_transportelementcommon.htm" + }, + "Pset_TransportElementElevator": { + "properties": { + "ClearDepth": { + "description": "Clear depth of the object (elevator). It indicates the distance from the inner surface of the elevator door to the opposite surface of the elevator car. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "ClearHeight": { + "description": "Clear height of the object (elevator). The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "ClearWidth": { + "description": "Clear width of the object (elevator). It indicates the distance from the inner surfaces of the elevator car left and right from the elevator door. The shape information is provided in addition to the shape representation and the geometric parameters used within. In cases of inconsistency between the geometric parameters and the shape properties, provided in the attached property, the geometric parameters take precedence." + }, + "FireFightingLift": { + "description": "Indication whether the elevator is designed to serve as a fire fighting lift the case of fire (TRUE) or not (FALSE). A fire fighting lift is used by fire fighters to access the location of fire and to evacuate people." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_transportelementelevator.htm" + }, + "Pset_TubeBundleTypeCommon": { + "properties": { + "FoulingFactor": { + "description": "Fouling factor of the tubes in the tube bundle." + }, + "HasTurbulator": { + "description": "TRUE if the tube has a turbulator, FALSE if it does not." + }, + "HorizontalSpacing": { + "description": "Horizontal spacing between tubes in the tube bundle." + }, + "InLineRowSpacing": { + "description": "In-line tube row spacing." + }, + "InsideDiameter": { + "description": "Actual inner diameter of the tube in the tube bundle." + }, + "Length": { + "description": "Length of the tubes in the tube bundle." + }, + "NominalDiameter": { + "description": "Nominal diameter or width of the tubes in the tube bundle." + }, + "NumberOfCircuits": { + "description": "Number of parallel fluid tube circuits." + }, + "NumberOfRows": { + "description": "Number of tube rows in the tube bundle assembly." + }, + "OutsideDiameter": { + "description": "Actual outside diameter of the tube in the tube bundle." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "StaggeredRowSpacing": { + "description": "Staggered tube row spacing." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalConductivity": { + "description": "The thermal conductivity of the tube." + }, + "VerticalSpacing": { + "description": "Vertical spacing between tubes in the tube bundle." + }, + "Volume": { + "description": "Total volume of fluid in the tubes and their headers." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tubebundletypecommon.htm" + }, + "Pset_TubeBundleTypeFinned": { + "properties": { + "Diameter": { + "description": "Actual diameter of a fin for circular fins only." + }, + "FinCorrugatedType": { + "description": "Description of a fin corrugated type." + }, + "HasCoating": { + "description": "TRUE if the fin has a coating, FALSE if it does not." + }, + "Height": { + "description": "Length of the fin as measured perpendicular to the direction of airflow." + }, + "Length": { + "description": "Length of the fin as measured parallel to the direction of airflow." + }, + "Spacing": { + "description": "Distance between fins on a tube in the tube bundle." + }, + "ThermalConductivity": { + "description": "The thermal conductivity of the fin." + }, + "Thickness": { + "description": "Thickness of the fin." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_tubebundletypefinned.htm" + }, + "Pset_UnitaryControlElementPHistory": { + "properties": { + "Fan": { + "description": "Indicates fan operation where True is on, False is off, and Unknown is automatic." + }, + "Mode": { + "description": "Indicates operation mode corresponding to Pset_UnitaryControlTypeCommon.Mode. For example, 'HEAT', 'COOL', 'AUTO'." + }, + "SetPoint": { + "description": "Indicates the temperature setpoint. For thermostats with setbacks or separate high and low setpoints, then the time series may contain a pair of values at each entry where the first value is the heating setpoint (low) and the second value is the cooling setpoint (high)." + }, + "Temperature": { + "description": "Indicates the current measured temperature." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_unitarycontrolelementphistory.htm" + }, + "Pset_UnitaryControlElementTypeCommon": { + "properties": { + "Mode": { + "description": "Table mapping operation mode identifiers to descriptive labels, which may be used for interpreting Pset_UnitaryControlElementPHistory.Mode." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_unitarycontrolelementtypecommon.htm" + }, + "Pset_UnitaryControlElementTypeIndicatorPanel": { + "properties": { + "Application": { + "description": "The application of the unitary control element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_unitarycontrolelementtypeindicatorpanel.htm" + }, + "Pset_UnitaryControlElementTypeThermostat": { + "properties": { + "TemperatureSetPoint": { + "description": "The temperature setpoint range and default setpoint." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/pset/pset_unitarycontrolelementtypethermostat.htm" + }, + "Pset_UnitaryEquipmentTypeAirConditioningUnit": { + "properties": { + "CondenserEnteringTemperature": { + "description": "Temperature of fluid entering condenser." + }, + "CondenserFlowrate": { + "description": "Flow rate of fluid through the condenser." + }, + "CondenserLeavingTemperature": { + "description": "Termperature of fluid leaving condenser." + }, + "CoolingEfficiency": { + "description": "Coefficient of Performance: Ratio of cooling energy output to energy input under full load operating conditions." + }, + "HeatingCapacity": { + "description": "Heating capacity." + }, + "HeatingEfficiency": { + "description": "Heating efficiency under full load heating conditions." + }, + "LatentCoolingCapacity": { + "description": "Latent cooling capacity." + }, + "OutsideAirFlowrate": { + "description": "Flow rate of outside air entering the unit." + }, + "SensibleCoolingCapacity": { + "description": "Sensible cooling capacity." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_unitaryequipmenttypeairconditioningunit.htm" + }, + "Pset_UnitaryEquipmentTypeAirHandler": { + "properties": { + "AirHandlerConstruction": { + "description": "Enumeration defining how the air handler might be fabricated." + }, + "AirHandlerFanCoilArrangement": { + "description": "Enumeration defining the arrangement of the supply air fan and the cooling coil." + }, + "DualDeck": { + "description": "Does the AirHandler have a dual deck? TRUE = Yes, FALSE = No." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_unitaryequipmenttypeairhandler.htm" + }, + "Pset_UnitaryEquipmentTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_unitaryequipmenttypecommon.htm" + }, + "Pset_UtilityConsumptionPHistory": { + "properties": { + "Electricity": { + "description": "The amount of electricity consumed during the period specified in the time series." + }, + "Fuel": { + "description": "The amount of fuel consumed during the period specified in the time series." + }, + "Heat": { + "description": "The amount of heat energy consumed during the period specified in the time series." + }, + "Steam": { + "description": "The amount of steam consumed during the period specified in the time series." + }, + "Water": { + "description": "The amount of water consumed during the period specified in the time series." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/pset/pset_utilityconsumptionphistory.htm" + }, + "Pset_ValvePHistory": { + "properties": { + "MeasuredFlowRate": { + "description": "The rate of flow of a fluid measured across the valve." + }, + "MeasuredPressureDrop": { + "description": "The actual pressure drop in the fluid measured across the valve." + }, + "PercentageOpen": { + "description": "The ratio between the amount that the valve is open to the full open position of the valve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvephistory.htm" + }, + "Pset_ValveTypeAirRelease": { + "properties": { + "IsAutomatic": { + "description": "Indication of whether the valve is automatically operated (TRUE) or manually operated (FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypeairrelease.htm" + }, + "Pset_ValveTypeCommon": { + "properties": { + "CloseOffRating": { + "description": "Close off rating." + }, + "FlowCoefficient": { + "description": "Flow coefficient (the quantity of fluid that passes through a fully open valve at unit pressure drop), typically expressed as the Kv or Cv value for the valve." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Size": { + "description": "The size of the connection to the valve (or to each connection for faucets, mixing valves, etc.)." + }, + "Status": {}, + "TestPressure": { + "description": "The maximum pressure to which the valve has been subjected under test." + }, + "ValveMechanism": { + "description": "The mechanism by which the valve function is achieved where:" + }, + "ValveOperation": { + "description": "The method of valve operation where:" + }, + "ValvePattern": { + "description": "The configuration of the ports of a valve according to either the linear route taken by a fluid flowing through the valve or by the number of ports where:" + }, + "WorkingPressure": { + "description": "The normally expected maximum working pressure of the valve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypecommon.htm" + }, + "Pset_ValveTypeDrawOffCock": { + "properties": { + "HasHoseUnion": { + "description": "Indicates whether the drawoff cock is fitted with a hose union connection (= TRUE) or not (= FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypedrawoffcock.htm" + }, + "Pset_ValveTypeFaucet": { + "properties": { + "FaucetFunction": { + "description": "Defines the operating temperature of a faucet that may be specified." + }, + "FaucetOperation": { + "description": "Defines the range of ways in which a faucet can be operated that may be specified where:" + }, + "FaucetTopDescription": { + "description": "Description of the operating mechanism/top of the faucet." + }, + "FaucetType": { + "description": "Defines the range of faucet types that may be specified where:" + }, + "Finish": { + "description": "Description of the finish applied to the faucet." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypefaucet.htm" + }, + "Pset_ValveTypeFlushing": { + "properties": { + "FlushingRate": { + "description": "The predetermined quantity of water to be flushed." + }, + "HasIntegralShutOffDevice": { + "description": "Indication of whether the flushing valve has an integral shut off device fitted (set TRUE) or not (set FALSE)." + }, + "IsHighPressure": { + "description": "Indication of whether the flushing valve is suitable for use on a high pressure water main (set TRUE) or not (set FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypeflushing.htm" + }, + "Pset_ValveTypeGasTap": { + "properties": { + "HasHoseUnion": { + "description": "Indicates whether the gas tap is fitted with a hose union connection (= TRUE) or not (= FALSE)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypegastap.htm" + }, + "Pset_ValveTypeIsolating": { + "properties": { + "IsNormallyOpen": { + "description": "If TRUE, the valve is normally open. If FALSE is is normally closed." + }, + "IsolatingPurpose": { + "description": "Defines the purpose for which the isolating valve is used since the way in which the valve is identified as an isolating valve may be in the context of its use. Note that unless there is a contextual name for the isolating valve (as in the case of a Landing Valve on a rising fire main), then the value assigned shoulkd be UNSET." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypeisolating.htm" + }, + "Pset_ValveTypeMixing": { + "properties": { + "MixerControl": { + "description": "Defines the form of control of the mixing valve." + }, + "OutletConnectionSize": { + "description": "The size of the pipework connection from the mixing valve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypemixing.htm" + }, + "Pset_ValveTypePressureReducing": { + "properties": { + "DownstreamPressure": { + "description": "The operating pressure of the fluid downstream of the pressure reducing valve." + }, + "UpstreamPressure": { + "description": "The operating pressure of the fluid upstream of the pressure reducing valve." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypepressurereducing.htm" + }, + "Pset_ValveTypePressureRelief": { + "properties": { + "ReliefPressure": { + "description": "The pressure at which the spring or weight in the valve is set to discharge fluid." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_valvetypepressurerelief.htm" + }, + "Pset_VibrationIsolatorTypeCommon": { + "properties": { + "IsolatorCompressibility": { + "description": "The compressibility of the vibration isolator." + }, + "IsolatorStaticDeflection": { + "description": "Static deflection of the vibration isolator." + }, + "MaximumSupportedWeight": { + "description": "The maximum weight that can be carried by the vibration isolator." + }, + "NominalHeight": { + "description": "Height of the vibration isolator before the application of load." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1')." + }, + "Status": {}, + "VibrationTransmissibility": { + "description": "The vibration transmissibility percentage." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/pset/pset_vibrationisolatortypecommon.htm" + }, + "Pset_WallCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "Combustible": { + "description": "Indication whether the object is made from combustible material (TRUE) or not (FALSE)." + }, + "Compartmentation": { + "description": "Indication whether the object is designed to serve as a fire compartmentation (TRUE) or not (FALSE)." + }, + "ExtendToStructure": { + "description": "Indicates whether the object extend to the structure above (TRUE) or not (FALSE)." + }, + "FireRating": { + "description": "Fire rating given according to the national fire safety classification." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "LoadBearing": { + "description": "Indicates whether the object is intended to carry loads (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "SurfaceSpreadOfFlame": { + "description": "Indication on how the flames spread around the surface, It is given according to the national building code that governs the fire behaviour for materials." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. Here the total thermal transmittance coefficient through the wall (including all materials)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_wallcommon.htm" + }, + "Pset_Warranty": { + "properties": { + "Exclusions": { + "description": "Items, conditions or actions that may be excluded from the warranty or that may cause the warranty to become void." + }, + "IsExtendedWarranty": { + "description": "Indication of whether this is an extended warranty whose duration is greater than that normally assigned to an artefact (=TRUE) or not (= FALSE)." + }, + "PointOfContact": { + "description": "The organization that should be contacted for action under the terms of the warranty. Note that the role of the organization (manufacturer, supplier, installer etc.) is determined by the IfcActorRole attribute of IfcOrganization." + }, + "WarrantyContent": { + "description": "The content of the warranty." + }, + "WarrantyEndDate": { + "description": "The date on which the warranty expires." + }, + "WarrantyIdentifier": { + "description": "The identifier assigned to a warranty." + }, + "WarrantyPeriod": { + "description": "The time duration during which a manufacturer or supplier guarantees or warrants the performance of an artefact." + }, + "WarrantyStartDate": { + "description": "The date on which the warranty commences." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedfacilitieselements/pset/pset_warranty.htm" + }, + "Pset_WasteTerminalTypeCommon": { + "properties": { + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), provided, if there is no classification reference to a recognized classification system used." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypecommon.htm" + }, + "Pset_WasteTerminalTypeFloorTrap": { + "properties": { + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the trap." + }, + "CoverMaterial": { + "description": "Material from which the cover or grating is constructed." + }, + "CoverWidth": { + "description": "The length measured along the y-axis in the local coordinate system of the cover of the trap." + }, + "HasStrainer": { + "description": "Indicates whether the gully trap has a strainer (= TRUE) or not (= FALSE)." + }, + "InletConnectionSize": { + "description": "Size of the inlet connection(s), where used, of the inlet connections." + }, + "InletPatternType": { + "description": "Identifies the pattern of inlet connections to a trap." + }, + "IsForSullageWater": { + "description": "Indicates if the purpose of the floor trap is to receive sullage water, or if that is amongst its purposes (= TRUE), or not (= FALSE). Note that if TRUE, it is expected that an upstand or kerb will be placed around the floor trap to prevent the ingress of surface water runoff; the provision of the upstand or kerb is not dealt with in this property set." + }, + "NominalBodyDepth": { + "description": "Nominal or quoted length measured along the z-axis in the local coordinate system of the chamber of the trap." + }, + "NominalBodyLength": { + "description": "Nominal or quoted length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the chamber of the trap." + }, + "NominalBodyWidth": { + "description": "Nominal or quoted length measured along the y-axis in the local coordinate system of the chamber of the trap." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + }, + "SpilloverLevel": { + "description": "The level at which water spills out of the terminal." + }, + "TrapType": { + "description": "Identifies the predefined types of waste trap used in combination with the floor trap from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypefloortrap.htm" + }, + "Pset_WasteTerminalTypeFloorWaste": { + "properties": { + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the waste." + }, + "CoverWidth": { + "description": "The length measured along the y-axis in the local coordinate system of the cover of the waste." + }, + "NominalBodyDepth": { + "description": "Nominal or quoted length measured along the z-axis in the local coordinate system of the waste." + }, + "NominalBodyLength": { + "description": "Nominal or quoted length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the waste." + }, + "NominalBodyWidth": { + "description": "Nominal or quoted length measured along the y-axis in the local coordinate system of the waste." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypefloorwaste.htm" + }, + "Pset_WasteTerminalTypeGullySump": { + "properties": { + "BackInletPatternType": { + "description": "Identifies the pattern of inlet connections to a gully trap." + }, + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the gully trap." + }, + "CoverWidth": { + "description": "The length measured along the y-axis in the local coordinate system of the cover of the gully trap." + }, + "GullyType": { + "description": "Identifies the predefined types of gully from which the type required may be set." + }, + "InletConnectionSize": { + "description": "Size of the inlet connection(s), where used, of the inlet connections." + }, + "NominalSumpDepth": { + "description": "Nominal or quoted length measured along the z-axis in the local coordinate system of the sump." + }, + "NominalSumpLength": { + "description": "Nominal or quoted length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the sump." + }, + "NominalSumpWidth": { + "description": "Nominal or quoted length measured along the y-axis in the local coordinate system of the sump." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + }, + "TrapType": { + "description": "Identifies the predefined types of trap from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypegullysump.htm" + }, + "Pset_WasteTerminalTypeGullyTrap": { + "properties": { + "BackInletPatternType": { + "description": "Identifies the pattern of inlet connections to a gully trap." + }, + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the gully trap." + }, + "CoverWidth": { + "description": "The length measured along the y-axis in the local coordinate system of the cover of the gully trap." + }, + "GullyType": { + "description": "Identifies the predefined types of gully from which the type required may be set." + }, + "HasStrainer": { + "description": "Indicates whether the gully trap has a strainer (= TRUE) or not (= FALSE)." + }, + "InletConnectionSize": { + "description": "Size of the inlet connection(s), where used, of the inlet connections." + }, + "NominalBodyDepth": { + "description": "Nominal or quoted length measured along the z-axis in the local coordinate system of the chamber of the gully trap." + }, + "NominalBodyLength": { + "description": "Nominal or quoted length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the chamber of the gully trap." + }, + "NominalBodyWidth": { + "description": "Nominal or quoted length measured along the y-axis in the local coordinate system of the chamber of the gully trap." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + }, + "TrapType": { + "description": "Identifies the predefined types of trap from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypegullytrap.htm" + }, + "Pset_WasteTerminalTypeRoofDrain": { + "properties": { + "CoverLength": { + "description": "The length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the cover of the drain." + }, + "CoverWidth": { + "description": "The length measured along the y-axis in the local coordinate system of the cover of the drain." + }, + "NominalBodyDepth": { + "description": "Nominal or quoted length measured along the z-axis in the local coordinate system of the drain." + }, + "NominalBodyLength": { + "description": "Nominal or quoted length measured along the x-axis in the local coordinate system or the radius (in the case of a circular shape in plan) of the drain." + }, + "NominalBodyWidth": { + "description": "Nominal or quoted length measured along the y-axis in the local coordinate system of the drain." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltyperoofdrain.htm" + }, + "Pset_WasteTerminalTypeWasteDisposalUnit": { + "properties": { + "DrainConnectionSize": { + "description": "Size of the drain connection inlet to the waste disposal unit." + }, + "NominalDepth": { + "description": "Nominal or quoted depth of the object measured from the inlet drain connection to the base of the unit." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the waste disposal unit." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypewastedisposalunit.htm" + }, + "Pset_WasteTerminalTypeWasteTrap": { + "properties": { + "InletConnectionSize": { + "description": "Size of the inlet connection(s), where used, of the inlet connections." + }, + "OutletConnectionSize": { + "description": "Size of the outlet connection from the object." + }, + "WasteTrapType": { + "description": "Identifies the predefined types of trap from which the type required may be set." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/pset/pset_wasteterminaltypewastetrap.htm" + }, + "Pset_WindowCommon": { + "properties": { + "AcousticRating": { + "description": "Acoustic rating for this object. It is provided according to the national building code. It indicates the sound transmission resistance of this object by an index ratio (instead of providing full sound absorbtion values)." + }, + "FireExit": { + "description": "Indication whether this object is designed to serve as an exit in the case of fire (TRUE) or not (FALSE). Here it defines an exit window in accordance to the national building code." + }, + "FireRating": { + "description": "Fire rating for this object. It is given according to the national fire safety classification." + }, + "GlazingAreaFraction": { + "description": "Fraction of the glazing area relative to the total area of the filling element. It shall be used, if the glazing area is not given separately for all panels within the filling element." + }, + "HasDrive": { + "description": "Indication whether this object has an automatic drive to operate it (TRUE) or no drive (FALSE)" + }, + "HasSillExternal": { + "description": "Indication whether the window opening has an external sill (TRUE) or not (FALSE)." + }, + "HasSillInternal": { + "description": "Indication whether the window opening has an internal sill (TRUE) or not (FALSE)." + }, + "Infiltration": { + "description": "Infiltration flowrate of outside air for the filler object based on the area of the filler object at a pressure level of 50 Pascals. It shall be used, if the length of all joints is unknown." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external element and faces the outside of the building." + }, + "MechanicalLoadRating": { + "description": "Mechanical load rating for this object. It is provided according to the national building code." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'), Also referred to as \"construction type\". It should be provided as an alternative to the name of the \"object type\", if the software does not support object types." + }, + "SecurityRating": { + "description": "Index based rating system indicating security level. It is giving according to the national building code." + }, + "SmokeStop": { + "description": "Indication whether the object is designed to provide a smoke stop (TRUE) or not (FALSE)." + }, + "Status": { + "description": "Status of the element, predominately used in renovation or retrofitting projects. The status can be assigned to as \"New\" - element designed as new addition, \"Existing\" - element exists and remains, \"Demolish\" - element existed but is to be demolished, \"Temporary\" - element will exists only temporary (like a temporary support structure)." + }, + "ThermalTransmittance": { + "description": "Thermal transmittance coefficient (U-Value) of a material. It applies to the total door construction." + }, + "WaterTightnessRating": { + "description": "Water tightness rating for this object. It is provided according to the national building code." + }, + "WindLoadRating": { + "description": "Wind load resistance rating for this object. It is provided according to the national building code." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/pset/pset_windowcommon.htm" + }, + "Pset_WorkControlCommon": { + "properties": { + "WorkDayDuration": { + "description": "The elapsed time within a worktime-based day. For presentation purposes, applications may choose to display IfcTask durations in work days where IfcTaskTime.DurationType=WORKTIME. This value must be less than or equal to 24 hours (an elapsed day); if omitted then 8 hours is assumed." + }, + "WorkFinishTime": { + "description": "The default time of day a task is scheduled to finish. For presentation purposes, if the finish time of a task matches the WorkFinishTime, then applications may choose to display the date only. Conversely when entering dates without specifying time, applications may automatically append the WorkFinishTime." + }, + "WorkMonthDuration": { + "description": "The elapsed time within a worktime-based month. For presentation purposes, applications may choose to display IfcTask durations in work months where IfcTaskTime.DurationType=WORKTIME. This value must be less than or equal to 744 hours (an elapsed month of 31 days); if omitted then 160 hours is assumed." + }, + "WorkStartTime": { + "description": "The default time of day a task is scheduled to start. For presentation purposes, if the start time of a task matches the WorkStartTime, then applications may choose to display the date only. Conversely when entering dates without specifying time, applications may automatically append the WorkStartTime." + }, + "WorkWeekDuration": { + "description": "The elapsed time within a worktime-based week. For presentation purposes, applications may choose to display IfcTask durations in work weeks where IfcTaskTime.DurationType=WORKTIME. This value must be less than or equal to 168 hours (an elapsed week); if omitted then 40 hours is assumed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcprocessextension/pset/pset_workcontrolcommon.htm" + }, + "Pset_ZoneCommon": { + "properties": { + "GrossPlannedArea": { + "description": "Total planned gross area for the zone. Used for programming the zone." + }, + "HandicapAccessible": { + "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as an accessible space for handicapped people, e.g., for a public toilet (TRUE) or not (FALSE). This information is often used to declare the need for access for the disabled and for special design requirements of this space." + }, + "IsExternal": { + "description": "Indication whether the element is designed for use in the exterior (TRUE) or not (FALSE). If (TRUE) it is an external zone at the outside of the building." + }, + "NetPlannedArea": { + "description": "Total planned net area for the zone. Used for programming the zone." + }, + "PubliclyAccessible": { + "description": "Indication whether this space (in case of e.g., a toilet) is designed to serve as a publicly accessible space, e.g., for a public toilet (TRUE) or not (FALSE)." + }, + "Reference": { + "description": "Reference ID for this specified type in this project (e.g. type 'A-1'). Used to store the non-classification driven internal project type." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/pset/pset_zonecommon.htm" + }, + "Qto_ActuatorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_actuatorbasequantities.htm" + }, + "Qto_AirTerminalBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + }, + "Perimeter": { + "description": "Perimeter of the air terminal face plate." + }, + "TotalSurfaceArea": { + "description": "Gross area of the air terminal face plate." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_airterminalbasequantities.htm" + }, + "Qto_AirTerminalBoxTypeBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_airterminalboxtypebasequantities.htm" + }, + "Qto_AirToAirHeatRecoveryBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_airtoairheatrecoverybasequantities.htm" + }, + "Qto_AlarmBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_alarmbasequantities.htm" + }, + "Qto_AudioVisualApplianceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_audiovisualappliancebasequantities.htm" + }, + "Qto_BeamBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Total area of the cross section (or profile) of the beam." + }, + "GrossSurfaceArea": { + "description": "Total area of the beam, normally generated as perimeter * length + 2 * cross section area. It is the sum of OuterSurfaceArea + (2 x CrossSectionArea) and shall only be given, if the OuterSurfaceArea and CrossSectionArea cannot be established separately." + }, + "GrossVolume": { + "description": "Total gross volume of the beam, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "GrossWeight": { + "description": "Total gross weight of the beam without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Length": { + "description": "Total length of the beam, not taking into account any cut-out's or other processing features." + }, + "NetSurfaceArea": { + "description": "Net surface area of the beam, normally generated as perimeter * length + 2 * cross section area taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetVolume": { + "description": "Total net volume of the beam, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetWeight": { + "description": "Total net weight of the beam without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the beam (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_beambasequantities.htm" + }, + "Qto_BoilerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element, not including contained fluid." + }, + "NetWeight": { + "description": "Weight of the element, including contained fluid as designed." + }, + "TotalSurfaceArea": { + "description": "Total surface area of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_boilerbasequantities.htm" + }, + "Qto_BuildingBaseQuantities": { + "properties": { + "EavesHeight": { + "description": "Standard net height of this storey, from the top surface of the construction floor, to the bottom surface of the construction floor or roof above. Only provided is there is a constant height." + }, + "FootprintArea": { + "description": "Gross area of the site covered by the building(s)." + }, + "GrossFloorArea": { + "description": "Sum of all gross areas of spaces within the building. It includes the area of construction elements within the building. May be provided in addition to the quantities of the spaces and the construction elements assigend to the building. In case of inconsistencies, the individual quantities of spaces and construction elements take precedence." + }, + "GrossVolume": { + "description": "Sum of all gross volumes of spaces enclosed by the building. It includes the volumes of construction elements within the building. May be provided in addition to the quantities of the spaces and the construction elements assigend to the building. In case of inconsistencies, the individual quantities of spaces and construction elements take precedence." + }, + "Height": { + "description": "Standard gross height of this building, from the top surface of the construction floor, to the top surface of the construction floor or roof above. Only provided is there is a constant height." + }, + "NetFloorArea": { + "description": "Sum of all net areas of spaces within the building. It excludes the area of construction elements within the building. May be provided in addition to the quantities of the spaces assigend to the building. In case of inconsistencies, the individual quantities of spaces take precedence." + }, + "NetVolume": { + "description": "Sum of all net volumes of spaces enclosed by the building. It iexcludes the volumes of construction elements within the building. May be provided in addition to the quantities of the spaces assigend to the building. In case of inconsistencies, the individual quantities of spaces take precedence." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_buildingbasequantities.htm" + }, + "Qto_BuildingElementProxyQuantities": { + "properties": { + "NetSurfaceArea": {}, + "NetVolume": {} + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_buildingelementproxyquantities.htm" + }, + "Qto_BuildingStoreyBaseQuantities": { + "properties": { + "GrossFloorArea": { + "description": "Sum of all gross areas of spaces within the building storey. It includes the area of construction elements within the building storey. May be provided in addition to the quantities of the spaces and the construction elements assigend to the storey. In case of inconsistencies, the individual quantities of spaces and construction elements take precedence." + }, + "GrossHeight": { + "description": "Standard gross height of this storey, from the top surface of the construction floor, to the top surface of the construction floor or roof above. Only provided is there is a constant height." + }, + "GrossPerimeter": { + "description": "Perimeter of the outer contour of the building story without taking interior slab openings into account." + }, + "GrossVolume": { + "description": "Sum of all gross volumes of spaces enclosed by the building storey. It includes the volumes of construction elements within the building storey. May be provided in addition to the quantities of the spaces and the construction elements assigend to the storey. In case of inconsistencies, the individual quantities of spaces and construction elements take precedence." + }, + "NetFloorArea": { + "description": "Sum of all net areas of spaces within the building storey. It excludes the area of construction elements within the building storey. May be provided in addition to the quantities of the spaces assigend to the storey. In case of inconsistencies, the individual quantities of spaces take precedence." + }, + "NetHeigtht": { + "description": "Standard net height of this storey, from the top surface of the construction floor, to the bottom surface of the construction floor or roof above. Only provided is there is a constant height." + }, + "NetVolume": { + "description": "Sum of all net volumes of spaces enclosed by the building storey. It iexcludes the volumes of construction elements within the building storey. May be provided in addition to the quantities of the spaces assigend to the storey. In case of inconsistencies, the individual quantities of spaces take precedence." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_buildingstoreybasequantities.htm" + }, + "Qto_BurnerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_burnerbasequantities.htm" + }, + "Qto_CableCarrierFittingBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_cablecarrierfittingbasequantities.htm" + }, + "Qto_CableCarrierSegmentBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Area of the cross section." + }, + "GrossWeight": { + "description": "Weight of the element." + }, + "Length": { + "description": "Length of the segment, calculated at midpoint of cross-section, equal to the distance between inlet and outlet ports." + }, + "OuterSurfaceArea": { + "description": "Total surface area." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_cablecarriersegmentbasequantities.htm" + }, + "Qto_CableFittingBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_cablefittingbasequantities.htm" + }, + "Qto_CableSegmentBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Area of the cross section." + }, + "GrossWeight": { + "description": "Weight of the element." + }, + "Length": { + "description": "Length of the segment, calculated at midpoint of cross-section, equal to the distance between inlet and outlet ports." + }, + "OuterSurfaceArea": { + "description": "Total surface area of the cable." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_cablesegmentbasequantities.htm" + }, + "Qto_ChillerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_chillerbasequantities.htm" + }, + "Qto_ChimneyBaseQuantities": { + "properties": { + "Length": { + "description": "Total length of the chimney from the foundation (or beginning) to the top not taking into account any cut-out's or other processing features." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_chimneybasequantities.htm" + }, + "Qto_CoilBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_coilbasequantities.htm" + }, + "Qto_ColumnBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Total area of the cross section (or profile) of the column." + }, + "GrossSurfaceArea": { + "description": "Total area of the column, normally generated as perimeter * length + 2 * cross section area. It is the sum of OuterSurfaceArea + (2 x CrossSectionArea) and shall only be given, if the OuterSurfaceArea and CrossSectionArea cannot be established separately." + }, + "GrossVolume": { + "description": "Total gross volume of the column, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "GrossWeight": { + "description": "Total gross weight of the column without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Length": { + "description": "Total length of the column not taking into account any cut-out's or other processing features." + }, + "NetSurfaceArea": { + "description": "Net surface area of the column, normally generated as perimeter * length + 2 * cross section area taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetVolume": { + "description": "Total net volume of the column, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetWeight": { + "description": "Total net weight of the column without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the column (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_columnbasequantities.htm" + }, + "Qto_CommunicationsApplianceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_communicationsappliancebasequantities.htm" + }, + "Qto_CompressorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_compressorbasequantities.htm" + }, + "Qto_CondenserBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_condenserbasequantities.htm" + }, + "Qto_ConstructionEquipmentResourceBaseQuantities": { + "properties": { + "OperatingTime": { + "description": "Productive time using the equipment including operating time and excluding idle time." + }, + "UsageTime": { + "description": "Total time using the equipment including operating time and idle time." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/qset/qto_constructionequipmentresourcebasequantities.htm" + }, + "Qto_ConstructionMaterialResourceBaseQuantities": { + "properties": { + "GrossVolume": { + "description": "Total gross volume of the material, including material placed and wasted." + }, + "GrossWeight": { + "description": "Total gross weight of the material, including material placed and wasted." + }, + "NetVolume": { + "description": "Total net volume of the material, including material placed but excluding material wasted." + }, + "NetWeight": { + "description": "Total net weight of the material, including material placed but excluding material wasted." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/qset/qto_constructionmaterialresourcebasequantities.htm" + }, + "Qto_ControllerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_controllerbasequantities.htm" + }, + "Qto_CooledBeamBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_cooledbeambasequantities.htm" + }, + "Qto_CoolingTowerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_coolingtowerbasequantities.htm" + }, + "Qto_CoveringBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Sum of all gross areas of the covering facing the space. No opening that is included in the covering is subtracted." + }, + "NetArea": { + "description": "Sum of all net areas of the covering facing the space. All openings that is included in the covering are subtracted." + }, + "Width": { + "description": "Nominal width (or thickness) of the plate. Only given, if the covering is prismatic (constant thickess)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_coveringbasequantities.htm" + }, + "Qto_CurtainWallQuantities": { + "properties": { + "GrossSideArea": { + "description": "Area of the curtain wall as viewed by an elevation view of the middle plane of the curtain wall. It does not take into account any curtain wall modifications." + }, + "Height": { + "description": "Total height of the curtain wall. It should only be provided, if it is constant along the curtain wall path." + }, + "Length": { + "description": "Total length of the curtain wall along the cutain wall center line (even if different to the curtain wall path)." + }, + "NetSideArea": { + "description": "Area of the curtain wall as viewed by an elevation view of the middle plane of the curtain wall. It does take into account all curtain wall modifications." + }, + "Width": { + "description": "Thickness of the curtain wall. It should only be provided, if it is constant along the curtain wall path." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_curtainwallquantities.htm" + }, + "Qto_DamperBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_damperbasequantities.htm" + }, + "Qto_DistributionChamberElementBaseQuantities": { + "properties": { + "GrossSurfaceArea": { + "description": "Total gross area of the inner surface of the chamber, not taking into account openings such as for pipes, ducts, or cables." + }, + "GrossVolume": { + "description": "Total gross volume of the chamber, not taking into account any enclosed elements such as pipes, ducts, cables, or equipment." + }, + "NetSurfaceArea": { + "description": "Total net area of the inner surface of the chamber, subtracting any openings such as for pipes, ducts, or cables." + }, + "NetVolume": { + "description": "Total net volume of the chamber, subtracting any enclosed elements such as pipes, ducts, cables, or equipment." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgserviceelements/qset/qto_distributionchamberelementbasequantities.htm" + }, + "Qto_DoorBaseQuantities": { + "properties": { + "Area": { + "description": "Total area of the outer lining of the door." + }, + "Height": { + "description": "Total outer heigth of the door lining. It should only be provided, if it is a rectangular door." + }, + "Perimeter": { + "description": "Total perimeter of the outer lining of the door." + }, + "Width": { + "description": "Total outer width of the door lining. It should only be provided, if it is a rectangular door." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_doorbasequantities.htm" + }, + "Qto_DuctFittingBaseQuantities": { + "properties": { + "GrossCrossSectionArea": { + "description": "Area of the cross section at the inlet, including the duct fitting itself and the interior flow space." + }, + "GrossWeight": { + "description": "Weight of the duct fitting." + }, + "Length": { + "description": "Length of the fitting, calculated at midpoint of cross-section and equal to the distance along the flow path from the port inlet to the port outlet. For junction fittings, it indicates the length of the longest flow path." + }, + "NetCrossSectionArea": { + "description": "Area of the cross section at the inlet, including the duct fitting and excluding the interior flow space." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the fitting (not taking into account the end cap areas)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_ductfittingbasequantities.htm" + }, + "Qto_DuctSegmentBaseQuantities": { + "properties": { + "GrossCrossSectionArea": { + "description": "Area of the cross section, including the duct itself and the interior flow space." + }, + "GrossWeight": { + "description": "Weight of the duct segment." + }, + "Length": { + "description": "Length of the segment, calculated at midpoint of cross-section, equal to the distance between inlet and outlet ports." + }, + "NetCrossSectionArea": { + "description": "Area of the cross section of the duct, excluding the interior flow space." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the duct (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_ductsegmentbasequantities.htm" + }, + "Qto_DuctSilencerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_ductsilencerbasequantities.htm" + }, + "Qto_ElectricApplianceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electricappliancebasequantities.htm" + }, + "Qto_ElectricDistributionBoardBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + }, + "NumberOfCircuits": { + "description": "Number of circuits in the distribution board." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electricdistributionboardbasequantities.htm" + }, + "Qto_ElectricFlowStorageDeviceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electricflowstoragedevicebasequantities.htm" + }, + "Qto_ElectricGeneratorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electricgeneratorbasequantities.htm" + }, + "Qto_ElectricMotorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electricmotorbasequantities.htm" + }, + "Qto_ElectricTimeControlBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_electrictimecontrolbasequantities.htm" + }, + "Qto_EvaporativeCoolerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_evaporativecoolerbasequantities.htm" + }, + "Qto_EvaporatorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_evaporatorbasequantities.htm" + }, + "Qto_FanBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_fanbasequantities.htm" + }, + "Qto_FilterBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_filterbasequantities.htm" + }, + "Qto_FireSuppressionTerminalBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/qset/qto_firesuppressionterminalbasequantities.htm" + }, + "Qto_FlowInstrumentBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_flowinstrumentbasequantities.htm" + }, + "Qto_FlowMeterBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_flowmeterbasequantities.htm" + }, + "Qto_FootingBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Total area of the cross section (or profile) of the footing." + }, + "GrossSurfaceArea": { + "description": "Total area of the footing, normally generated as perimeter * length + 2 * cross section area. It is the sum of OuterSurfaceArea + (2 x CrossSectionArea) and shall only be given, if the OuterSurfaceArea and CrossSectionArea cannot be established separately." + }, + "GrossVolume": { + "description": "Total gross volume of the footing, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "GrossWeight": { + "description": "Total gross weight of the footing without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Height": { + "description": "Total nominal height of the footing. It should only be provided, if it is constant." + }, + "Length": { + "description": "Length of the footing, not taking into account any cut-out's or other processing features. For strip footings it is measured along the path, for other footings it is one of the horizontal dimensions. It should only be provided, if it is constant." + }, + "NetVolume": { + "description": "Total net volume of the footing, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetWeight": { + "description": "Total net weight of the footing without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the footing (not taking into account the end cap areas), normally generated as perimeter * length." + }, + "Width": { + "description": "Total nominal width (or thickness) of the footing. For strip footings it is measured perpendicular to the footing path (or longitudial axis). For other footings it is one of the horizontal dimensions. It should only be provided, if it is constant." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/qset/qto_footingbasequantities.htm" + }, + "Qto_HeatExchangerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_heatexchangerbasequantities.htm" + }, + "Qto_HumidifierBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_humidifierbasequantities.htm" + }, + "Qto_InterceptorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/qset/qto_interceptorbasequantities.htm" + }, + "Qto_JunctionBoxBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + }, + "NumberOfGangs": { + "description": "Number of gangs in the junction box." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_junctionboxbasequantities.htm" + }, + "Qto_LaborResourceBaseQuantities": { + "properties": { + "OvertimeWork": { + "description": "Work that is performed after exceeding a particular limit such as hours per day and/or hours per week, after which company or municipal policy requires a different rate to apply. Note: Policies for when overtime takes effect are the responsibility of the user or application; they are not modelled in IFC." + }, + "StandardWork": { + "description": "Work that is performed at regular times, up to a particular limit after which overtime rates may apply." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcconstructionmgmtdomain/qset/qto_laborresourcebasequantities.htm" + }, + "Qto_LampBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_lampbasequantities.htm" + }, + "Qto_LightFixtureBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_lightfixturebasequantities.htm" + }, + "Qto_MemberBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Total area of the cross section (or profile) of the member." + }, + "GrossSurfaceArea": { + "description": "Total area of the member, normally generated as perimeter * length + 2 * cross section area. It is the sum of OuterSurfaceArea + (2 x CrossSectionArea) and shall only be given, if the OuterSurfaceArea and CrossSectionArea cannot be established separately." + }, + "GrossVolume": { + "description": "Total gross volume of the member, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "GrossWeight": { + "description": "Total gross weight of the member without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Length": { + "description": "Total nominal length of the member, not taking into account any cut-out's or other processing features." + }, + "NetSurfaceArea": { + "description": "Net surface area of the member, normally generated as perimeter * length + 2 * cross section area taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetVolume": { + "description": "Total net volume of the member, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetWeight": { + "description": "Total net weight of the member without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the member (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_memberbasequantities.htm" + }, + "Qto_MotorConnectionBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_motorconnectionbasequantities.htm" + }, + "Qto_OpeningElementBaseQuantities": { + "properties": { + "Area": { + "description": "Area of the opening as viewed by an elevation view (for wall openings) or as viewed by a ground floor view (for slab openings)." + }, + "Depth": { + "description": "Depth (or thickness) of the opening, in case of openings it shall be identical to the width (or thickness) of the voided element, in case of recesses it shall be less. Only provided, if the depth is constant." + }, + "Height": { + "description": "Height of the opening, in case of wall openings it is the vertical dimension in case of slab openings it is one horizontal dimension. Only provided, if the area is rectangular." + }, + "Volume": { + "description": "Volume of the opening. It is the subtraction volume of the opening from the voided element (e.g. wall or slab). In case that the geometric volume of the opening is bigger then the subtraction volume, only the subtraction volume should be used." + }, + "Width": { + "description": "Width of the opening, in case of wall openings it is the horizontal dimension in case of slab openings it is one horizontal dimension. Only provided, if the area is rectangular." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_openingelementbasequantities.htm" + }, + "Qto_OutletBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_outletbasequantities.htm" + }, + "Qto_PileBaseQuantities": { + "properties": { + "CrossSectionArea": { + "description": "Total area of the cross section (or profile) of the pile." + }, + "GrossSurfaceArea": { + "description": "Total area of the pile, normally generated as perimeter * length + 2 * cross section area. It is the sum of OuterSurfaceArea + (2 x CrossSectionArea) and shall only be given, if the OuterSurfaceArea and CrossSectionArea cannot be established separately." + }, + "GrossVolume": { + "description": "Total gross volume of the pile, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "GrossWeight": { + "description": "Total gross weight of the pile without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Length": { + "description": "Total length of the pile not taking into account any cut-out's or other processing features." + }, + "NetVolume": { + "description": "Total net volume of the pile, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetWeight": { + "description": "Total net weight of the pile without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the pile (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/qset/qto_pilebasequantities.htm" + }, + "Qto_PipeFittingBaseQuantities": { + "properties": { + "GrossCrossSectionArea": { + "description": "Area of the cross section at the inlet, including the pipe fitting itself and the interior flow space." + }, + "GrossWeight": { + "description": "Weight of the pipe fitting itself, not including contained fluid." + }, + "Length": { + "description": "Length of the fitting, calculated at midpoint of cross-section and equal to the distance along the flow path from the port inlet to the port outlet. For junction fittings, it indicates the length of the longest flow path." + }, + "NetCrossSectionArea": { + "description": "Area of the cross section at the inlet, including the pipe fitting and excluding the interior flow space." + }, + "NetWeight": { + "description": "Weight of the pipe fitting, including contained fluid as designed." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the fitting (not taking into account the end cap areas)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_pipefittingbasequantities.htm" + }, + "Qto_PipeSegmentBaseQuantities": { + "properties": { + "GrossCrossSectionArea": { + "description": "Area of the cross section, including the pipe itself and the interior flow space." + }, + "GrossWeight": { + "description": "Weight of the pipe segment itself, not including contained fluid." + }, + "Length": { + "description": "Length of the segment, calculated at midpoint of cross-section, equal to the distance between inlet and outlet ports." + }, + "NetCrossSectionArea": { + "description": "Area of the cross section of the pipe, excluding the interior flow space." + }, + "NetWeight": { + "description": "Weight of the pipe segment, including contained fluid as designed." + }, + "OuterSurfaceArea": { + "description": "Total area of the extruded surfaces of the pipe (not taking into account the end cap areas), normally generated as perimeter * length." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_pipesegmentbasequantities.htm" + }, + "Qto_PlateBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Total area of the extruded area of the plate. Openings, recesses and projections are not taken into account. Only given, if the plate is prismatic." + }, + "GrossVolume": { + "description": "Total gross volume of the plate. Openings, recesses, and projections are not taken into account." + }, + "GrossWeight": { + "description": "Total gross weight of the plate without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "NetArea": { + "description": "Total area of the extruded area of the plate. Openings and recesses are taken into account by subtraction, projections by addition. Only given, if the plate is prismatic." + }, + "NetVolume": { + "description": "Total net volume of the plate. Openings and recesses are taken into account by subtraction, projections by addition." + }, + "NetWeight": { + "description": "Total net weight of the plate without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Perimeter": { + "description": "Perimeter measured along the outer boundaries of the plate. Only given, if the plate is prismatic (constant thickness)." + }, + "Width": { + "description": "Nominal width (or thickness) of the plate. Only given, if the plate is prismatic (constant thickess)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_platebasequantities.htm" + }, + "Qto_ProjectionElementBaseQuantities": { + "properties": { + "Area": { + "description": "Area of the projection as viewed by an elevation view (for wall projections or as viewed by a ground floor view (for slab projections)." + }, + "Volume": { + "description": "Volume of the opening. It is the addition volume of the project to the element (e.g. wall or slab)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_projectionelementbasequantities.htm" + }, + "Qto_ProtectiveDeviceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_protectivedevicebasequantities.htm" + }, + "Qto_ProtectiveDeviceTrippingUnitBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_protectivedevicetrippingunitbasequantities.htm" + }, + "Qto_PumpBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_pumpbasequantities.htm" + }, + "Qto_RailingBaseQuantities": { + "properties": { + "Length": { + "description": "Total nominal length of the railing, not taking into account any cut-out's or other processing features." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_railingbasequantities.htm" + }, + "Qto_RampFlightBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Total area of the ramp flight (not the projected area). Openings, recesses and projections are not taken into account. Only given, if the ramp flight is prismatic." + }, + "GrossVolume": { + "description": "Total gross volume of the ramp flight. Openings, recesses, and projections are not taken into account." + }, + "Length": { + "description": "Total length of the ramp flight along the walking line." + }, + "NetArea": { + "description": "Total area of the ramp flight (not the projected area). Openings and recesses are taken into account by subtraction, projections by addition. Only given, if the ramp flight is prismatic." + }, + "NetVolume": { + "description": "Total net volume of the ramp flight. Openings and recesses are taken into account by subtraction, projections by addition." + }, + "Width": { + "description": "Thickness of the ramp flight. It should only be provided, if it is constant." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_rampflightbasequantities.htm" + }, + "Qto_ReinforcingElementBaseQuantities": { + "properties": { + "Count": { + "description": "Total count of reinforcing items." + }, + "Length": { + "description": "Total length of reinforcing." + }, + "Weight": { + "description": "Total weight of reinforcing." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcstructuralelementsdomain/qset/qto_reinforcingelementbasequantities.htm" + }, + "Qto_RoofBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Total gross area of the outer surface of the roof. It is the sum of all roof slab gross areas. Roof openings, like sky windows and other openings and cut-outs are not taken into account." + }, + "NetArea": { + "description": "Total net area of the outer surface of the roof. It is the suma of all roof slab net areas. Roof openings, like sky windows and other openings and cut-outs are taken into account." + }, + "ProjectedArea": { + "description": "Total gross area of the outer surfaces of the roof, projected tp the ground. It is the sum of all projected roof slab gross areas. Roof openings, like sky windows and other openings and cut-outs are not taken into account." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_roofbasequantities.htm" + }, + "Qto_SanitaryTerminalBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/qset/qto_sanitaryterminalbasequantities.htm" + }, + "Qto_SensorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_sensorbasequantities.htm" + }, + "Qto_SiteBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Gross area for this site, measured in horizontal projections." + }, + "GrossPerimeter": { + "description": "Perimeter of the site boundary, measured in horizontal projection." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_sitebasequantities.htm" + }, + "Qto_SlabBaseQuantities": { + "properties": { + "Depth": { + "description": "Depth (one direction of the non-projected foot print area) of the slab. It shall only be provided, if the slab is rectangular." + }, + "GrossArea": { + "description": "Total area of the extruded area of the slab. Openings, recesses and projections are not taken into account. Only given, if the slab is prismatic." + }, + "GrossVolume": { + "description": "Total gross volume of the slab. Openings, recesses, and projections are not taken into account." + }, + "GrossWeight": { + "description": "Total gross weight of the slab without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Length": { + "description": "Length (one direction of the non-projected foot print area) of the slab. It shall only be provided, if the slab is rectangular." + }, + "NetArea": { + "description": "Total area of the extruded area of the slab. Openings and recesses are taken into account by subtraction, projections by addition. Only given, if the slab is prismatic." + }, + "NetVolume": { + "description": "Total net volume of the slab. Openings and recesses are taken into account by subtraction, projections by addition." + }, + "NetWeight": { + "description": "Total net weight of the slab without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Perimeter": { + "description": "Perimeter measured along the outer boundaries of the slab. Only given, if the slab is prismatic (constant thickness)." + }, + "Width": { + "description": "Nominal width (or thickness) of the slab. Only given, if the slab is prismatic (constant thickess)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_slabbasequantities.htm" + }, + "Qto_SolarDeviceBaseQuantities": { + "properties": { + "GrossArea": { + "description": "Area of the solar device including the outer frame." + }, + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_solardevicebasequantities.htm" + }, + "Qto_SpaceBaseQuantities": { + "properties": { + "FinishCeilingHeight": { + "description": "Height of the suspended ceiling (from top of flooring to the bottom of the suspended ceiling). To be provided only if the space has a suspended ceiling with constant height." + }, + "FinishFloorHeight": { + "description": "Height of the flooring (from base slab without flooring to the flooring height). To be provided only if the space has a constant flooring height." + }, + "GrossCeilingArea": { + "description": "Sum of all ceiling areas of the space. It includes the area covered by elementsinside the space (columns, inner walls, etc.). The ceiling area is the real (and not the projected) area (e.g. in case of sloped ceilings)." + }, + "GrossFloorArea": { + "description": "Sum of all floor areas covered by the space. It includes the area covered by elementsinside the space (columns, inner walls, etc.) and excludes the area covered by wall claddings." + }, + "GrossPerimeter": { + "description": "Gross perimeter at the floor level of this space. It all sides of the space, including those parts of the perimeter that are created by virtual boundaries and openings (like doors)." + }, + "GrossVolume": { + "description": "Gross volume enclosed by the space, including the volume of construction elements inside the space." + }, + "GrossWallArea": { + "description": "Sum of all wall (and other vertically bounding elements, like columns) areas bounded by the space. It includes the area covered by elements inside the wall area (doors, windows, other openings, etc.)." + }, + "Height": { + "description": "Total height (from base slab without flooring to ceiling without suspended ceiling) for this space (measured from top of slab below to bottom of slab above). To be provided only if the space has a constant height." + }, + "NetCeilingArea": { + "description": "Sum of all ceiling areas of the space. It excludes the area covered by elementsinside the space (columns, inner walls, etc.). The ceiling area is the real (and not the projected) area (e.g. in case of sloped ceilings)." + }, + "NetFloorArea": { + "description": "Sum of all usable floor areas covered by the space. It excludes the area covered by elements inside the space (columns, inner walls, built-in's etc.), slab openings, or other protruding elements. Varying heights are not taking into account (i.e. no reduction for areas under a minimum headroom)." + }, + "NetPerimeter": { + "description": "Net perimeter at the floor level of this space. It excludes those parts of the perimeter that are created by by virtual boundaries and openings (like doors). It is the measurement used for skirting boards and may includes the perimeter of internal fixed objects like columns." + }, + "NetVolume": { + "description": "Net volume enclosed by the space, excluding the volume of construction elements inside the space." + }, + "NetWallArea": { + "description": "Sum of all wall (and other vertically bounding elements, like columns) areas bounded by the space. It excludes the area covered by elements inside the wall area (doors, windows, other openings, etc.)." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcproductextension/qset/qto_spacebasequantities.htm" + }, + "Qto_SpaceHeaterBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element itself, not including contained fluid." + }, + "Length": { + "description": "Length of the water tube inside the component, if applicable." + }, + "NetWeight": { + "description": "Weight of the element, including contained fluid as designed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_spaceheaterbasequantities.htm" + }, + "Qto_StackTerminalBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/qset/qto_stackterminalbasequantities.htm" + }, + "Qto_StairFlightBaseQuantities": { + "properties": { + "GrossVolume": { + "description": "Total gross volume of the stair flight. Openings, recesses, and projections are not taken into account." + }, + "Length": { + "description": "Total length of the stair flight along the walking line." + }, + "NetVolume": { + "description": "Total net volume of the stair flight. Openings and recesses are taken into account by subtraction, projections by addition." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_stairflightbasequantities.htm" + }, + "Qto_SwitchingDeviceBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_switchingdevicebasequantities.htm" + }, + "Qto_TankBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element itself, not including contained fluid." + }, + "NetWeight": { + "description": "Weight of the element, including contained fluid as designed." + }, + "TotalSurfaceArea": { + "description": "Total surface area of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_tankbasequantities.htm" + }, + "Qto_TransformerBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcelectricaldomain/qset/qto_transformerbasequantities.htm" + }, + "Qto_TubeBundleBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element itself, not including contained fluid." + }, + "NetWeight": { + "description": "Weight of the element, including contained fluid as designed." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_tubebundlebasequantities.htm" + }, + "Qto_UnitaryControlElementBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcbuildingcontrolsdomain/qset/qto_unitarycontrolelementbasequantities.htm" + }, + "Qto_UnitaryEquipmentBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_unitaryequipmentbasequantities.htm" + }, + "Qto_ValveBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_valvebasequantities.htm" + }, + "Qto_VibrationIsolatorBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifchvacdomain/qset/qto_vibrationisolatorbasequantities.htm" + }, + "Qto_WallBaseQuantities": { + "properties": { + "GrossFootprintArea": { + "description": "Area of the wall as viewed by a ground floor view, not taking any wall modifications (like recesses) into account. It is also referred to as the foot print of the wall." + }, + "GrossSideArea": { + "description": "Area of the wall as viewed by an elevation view of the middle plane of the wall. It does not take into account any wall modifications (such as openings)." + }, + "GrossVolume": { + "description": "Volume of the wall, without taking into account the openings and the connection geometry." + }, + "GrossWeight": { + "description": "Total gross weight of the wall, without add-on parts, not taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Height": { + "description": "Total nominal height of the wall. It should only be provided, if it is constant along the wall path." + }, + "Length": { + "description": "Total nominal length of the wall along the wall center line (even if different to the wall path)." + }, + "NetFootprintArea": { + "description": "Area of the wall as viewed by a ground floor view, taking all wall modifications (like recesses) into account. It is also referred to as the foot print of the wall." + }, + "NetSideArea": { + "description": "Area of the wall as viewed by an elevation view of the middle plane. It does take into account all wall modifications (such as openings)." + }, + "NetVolume": { + "description": "Volume of the wall, after subtracting the openings and after considering the connection geometry." + }, + "NetWeight": { + "description": "Total net weight of the wall, without add-on parts, taking into account possible processing features (cut-out's, etc.) or openings and recesses." + }, + "Width": { + "description": "Total nominal width (or thickness) of the wall measured perpendicular to the wall path. It should only be provided, if it is constant along the wall path." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_wallbasequantities.htm" + }, + "Qto_WasteTerminalBaseQuantities": { + "properties": { + "GrossWeight": { + "description": "Weight of the element." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcplumbingfireprotectiondomain/qset/qto_wasteterminalbasequantities.htm" + }, + "Qto_WindowBaseQuantities": { + "properties": { + "Area": { + "description": "Total area of the outer lining of the window." + }, + "Height": { + "description": "Total outer heigth of the window lining. It should only be provided, if it is a rectangular window." + }, + "Perimeter": { + "description": "Total perimeter of the outer lining of the window." + }, + "Width": { + "description": "Total outer width of the window lining. It should only be provided, if it is a rectangular window." + } + }, + "spec_url": "https://standards.buildingsmart.org/IFC/RELEASE/IFC4/ADD2_TC1/HTML/schema/ifcsharedbldgelements/qset/qto_windowbasequantities.htm" + } +} \ No newline at end of file diff --git a/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_property_sets_site_domains.json b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_property_sets_site_domains.json new file mode 100644 index 0000000000..b4f6ac8082 --- /dev/null +++ b/src/ifcopenshell-python/ifcopenshell/util/schema/ifc4_property_sets_site_domains.json @@ -0,0 +1,515 @@ +{ + "pset_actionrequest": "ifcsharedmgmtelements", + "pset_actorcommon": "ifckernel", + "pset_actuatorphistory": "ifcbuildingcontrolsdomain", + "pset_actuatortypecommon": "ifcbuildingcontrolsdomain", + "pset_actuatortypeelectricactuator": "ifcbuildingcontrolsdomain", + "pset_actuatortypehydraulicactuator": "ifcbuildingcontrolsdomain", + "pset_actuatortypelinearactuation": "ifcbuildingcontrolsdomain", + "pset_actuatortypepneumaticactuator": "ifcbuildingcontrolsdomain", + "pset_actuatortyperotationalactuation": "ifcbuildingcontrolsdomain", + "pset_airsidesysteminformation": "ifcsharedbldgserviceelements", + "pset_airterminalboxphistory": "ifchvacdomain", + "pset_airterminalboxtypecommon": "ifchvacdomain", + "pset_airterminaloccurrence": "ifchvacdomain", + "pset_airterminalphistory": "ifchvacdomain", + "pset_airterminaltypecommon": "ifchvacdomain", + "pset_airtoairheatrecoveryphistory": "ifchvacdomain", + "pset_airtoairheatrecoverytypecommon": "ifchvacdomain", + "pset_alarmphistory": "ifcbuildingcontrolsdomain", + "pset_alarmtypecommon": "ifcbuildingcontrolsdomain", + "pset_annotationcontourline": "ifcproductextension", + "pset_annotationlineofsight": "ifcproductextension", + "pset_annotationsurveyarea": "ifcproductextension", + "pset_asset": "ifcsharedfacilitieselements", + "pset_audiovisualappliancephistory": "ifcelectricaldomain", + "pset_audiovisualappliancetypeamplifier": "ifcelectricaldomain", + "pset_audiovisualappliancetypecamera": "ifcelectricaldomain", + "pset_audiovisualappliancetypecommon": "ifcelectricaldomain", + "pset_audiovisualappliancetypedisplay": "ifcelectricaldomain", + "pset_audiovisualappliancetypeplayer": "ifcelectricaldomain", + "pset_audiovisualappliancetypeprojector": "ifcelectricaldomain", + "pset_audiovisualappliancetypereceiver": "ifcelectricaldomain", + "pset_audiovisualappliancetypespeaker": "ifcelectricaldomain", + "pset_audiovisualappliancetypetuner": "ifcelectricaldomain", + "pset_beamcommon": "ifcsharedbldgelements", + "pset_boilerphistory": "ifchvacdomain", + "pset_boilertypecommon": "ifchvacdomain", + "pset_boilertypesteam": "ifchvacdomain", + "pset_boilertypewater": "ifchvacdomain", + "pset_buildingcommon": "ifcproductextension", + "pset_buildingelementproxycommon": "ifcsharedbldgelements", + "pset_buildingelementproxyprovisionforvoid": "ifcsharedbldgelements", + "pset_buildingstoreycommon": "ifcproductextension", + "pset_buildingsystemcommon": "ifcsharedbldgelements", + "pset_buildinguse": "ifcproductextension", + "pset_buildinguseadjacent": "ifcproductextension", + "pset_burnertypecommon": "ifchvacdomain", + "pset_cablecarrierfittingtypecommon": "ifcelectricaldomain", + "pset_cablecarriersegmenttypecableladdersegment": "ifcelectricaldomain", + "pset_cablecarriersegmenttypecabletraysegment": "ifcelectricaldomain", + "pset_cablecarriersegmenttypecabletrunkingsegment": "ifcelectricaldomain", + "pset_cablecarriersegmenttypecommon": "ifcelectricaldomain", + "pset_cablecarriersegmenttypeconduitsegment": "ifcelectricaldomain", + "pset_cablefittingtypecommon": "ifcelectricaldomain", + "pset_cablesegmentoccurrence": "ifcelectricaldomain", + "pset_cablesegmenttypebusbarsegment": "ifcelectricaldomain", + "pset_cablesegmenttypecablesegment": "ifcelectricaldomain", + "pset_cablesegmenttypecommon": "ifcelectricaldomain", + "pset_cablesegmenttypeconductorsegment": "ifcelectricaldomain", + "pset_cablesegmenttypecoresegment": "ifcelectricaldomain", + "pset_chillerphistory": "ifchvacdomain", + "pset_chillertypecommon": "ifchvacdomain", + "pset_chimneycommon": "ifcsharedbldgelements", + "pset_civilelementcommon": "ifcproductextension", + "pset_coiloccurrence": "ifchvacdomain", + "pset_coilphistory": "ifchvacdomain", + "pset_coiltypecommon": "ifchvacdomain", + "pset_coiltypehydronic": "ifchvacdomain", + "pset_columncommon": "ifcsharedbldgelements", + "pset_communicationsappliancephistory": "ifcelectricaldomain", + "pset_communicationsappliancetypecommon": "ifcelectricaldomain", + "pset_compressorphistory": "ifchvacdomain", + "pset_compressortypecommon": "ifchvacdomain", + "pset_concreteelementgeneral": "ifcstructuralelementsdomain", + "pset_condenserphistory": "ifchvacdomain", + "pset_condensertypecommon": "ifchvacdomain", + "pset_condition": "ifcsharedfacilitieselements", + "pset_constructionresource": "ifcconstructionmgmtdomain", + "pset_controllerphistory": "ifcbuildingcontrolsdomain", + "pset_controllertypecommon": "ifcbuildingcontrolsdomain", + "pset_controllertypefloating": "ifcbuildingcontrolsdomain", + "pset_controllertypemultiposition": "ifcbuildingcontrolsdomain", + "pset_controllertypeprogrammable": "ifcbuildingcontrolsdomain", + "pset_controllertypeproportional": "ifcbuildingcontrolsdomain", + "pset_controllertypetwoposition": "ifcbuildingcontrolsdomain", + "pset_cooledbeamphistory": "ifchvacdomain", + "pset_cooledbeamphistoryactive": "ifchvacdomain", + "pset_cooledbeamtypeactive": "ifchvacdomain", + "pset_cooledbeamtypecommon": "ifchvacdomain", + "pset_coolingtowerphistory": "ifchvacdomain", + "pset_coolingtowertypecommon": "ifchvacdomain", + "pset_coveringceiling": "ifcsharedbldgelements", + "pset_coveringcommon": "ifcsharedbldgelements", + "pset_coveringflooring": "ifcsharedbldgelements", + "pset_curtainwallcommon": "ifcsharedbldgelements", + "pset_damperoccurrence": "ifchvacdomain", + "pset_damperphistory": "ifchvacdomain", + "pset_dampertypecommon": "ifchvacdomain", + "pset_dampertypecontroldamper": "ifchvacdomain", + "pset_dampertypefiredamper": "ifchvacdomain", + "pset_dampertypefiresmokedamper": "ifchvacdomain", + "pset_dampertypesmokedamper": "ifchvacdomain", + "pset_discreteaccessorycolumnshoe": "ifcsharedcomponentelements", + "pset_discreteaccessorycornerfixingplate": "ifcsharedcomponentelements", + "pset_discreteaccessorydiagonaltrussconnector": "ifcsharedcomponentelements", + "pset_discreteaccessoryedgefixingplate": "ifcsharedcomponentelements", + "pset_discreteaccessoryfixingsocket": "ifcsharedcomponentelements", + "pset_discreteaccessoryladdertrussconnector": "ifcsharedcomponentelements", + "pset_discreteaccessorystandardfixingplate": "ifcsharedcomponentelements", + "pset_discreteaccessorywireloop": "ifcsharedcomponentelements", + "pset_distributionchamberelementcommon": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypeformedduct": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypeinspectionchamber": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypeinspectionpit": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypemanhole": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypemeterchamber": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypesump": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypetrench": "ifcsharedbldgserviceelements", + "pset_distributionchamberelementtypevalvechamber": "ifcsharedbldgserviceelements", + "pset_distributionportcommon": "ifcsharedbldgserviceelements", + "pset_distributionportphistorycable": "ifcsharedbldgserviceelements", + "pset_distributionportphistoryduct": "ifcsharedbldgserviceelements", + "pset_distributionportphistorypipe": "ifcsharedbldgserviceelements", + "pset_distributionporttypecable": "ifcsharedbldgserviceelements", + "pset_distributionporttypeduct": "ifcsharedbldgserviceelements", + "pset_distributionporttypepipe": "ifcsharedbldgserviceelements", + "pset_distributionsystemcommon": "ifcsharedbldgserviceelements", + "pset_distributionsystemtypeelectrical": "ifcsharedbldgserviceelements", + "pset_distributionsystemtypeventilation": "ifcsharedbldgserviceelements", + "pset_doorcommon": "ifcsharedbldgelements", + "pset_doorwindowglazingtype": "ifcsharedbldgelements", + "pset_ductfittingoccurrence": "ifchvacdomain", + "pset_ductfittingphistory": "ifchvacdomain", + "pset_ductfittingtypecommon": "ifchvacdomain", + "pset_ductsegmentoccurrence": "ifchvacdomain", + "pset_ductsegmentphistory": "ifchvacdomain", + "pset_ductsegmenttypecommon": "ifchvacdomain", + "pset_ductsilencerphistory": "ifchvacdomain", + "pset_ductsilencertypecommon": "ifchvacdomain", + "pset_electricaldevicecommon": "ifcelectricaldomain", + "pset_electricappliancephistory": "ifcelectricaldomain", + "pset_electricappliancetypecommon": "ifcelectricaldomain", + "pset_electricappliancetypedishwasher": "ifcelectricaldomain", + "pset_electricappliancetypeelectriccooker": "ifcelectricaldomain", + "pset_electricdistributionboardoccurrence": "ifcelectricaldomain", + "pset_electricdistributionboardtypecommon": "ifcelectricaldomain", + "pset_electricflowstoragedevicephistory": "ifcelectricaldomain", + "pset_electricflowstoragedevicetypecommon": "ifcelectricaldomain", + "pset_electricgeneratortypecommon": "ifcelectricaldomain", + "pset_electricmotortypecommon": "ifcelectricaldomain", + "pset_electrictimecontroltypecommon": "ifcelectricaldomain", + "pset_elementassemblycommon": "ifcproductextension", + "pset_elementcomponentcommon": "ifcsharedcomponentelements", + "pset_enginetypecommon": "ifchvacdomain", + "pset_environmentalimpactindicators": "ifcproductextension", + "pset_environmentalimpactvalues": "ifcproductextension", + "pset_evaporativecoolerphistory": "ifchvacdomain", + "pset_evaporativecoolertypecommon": "ifchvacdomain", + "pset_evaporatorphistory": "ifchvacdomain", + "pset_evaporatortypecommon": "ifchvacdomain", + "pset_fancentrifugal": "ifchvacdomain", + "pset_fanoccurrence": "ifchvacdomain", + "pset_fanphistory": "ifchvacdomain", + "pset_fantypecommon": "ifchvacdomain", + "pset_fastenerweld": "ifcsharedcomponentelements", + "pset_filterphistory": "ifchvacdomain", + "pset_filtertypeairparticlefilter": "ifchvacdomain", + "pset_filtertypecommon": "ifchvacdomain", + "pset_filtertypecompressedairfilter": "ifchvacdomain", + "pset_filtertypewaterfilter": "ifchvacdomain", + "pset_firesuppressionterminaltypebreechinginlet": "ifcplumbingfireprotectiondomain", + "pset_firesuppressionterminaltypecommon": "ifcplumbingfireprotectiondomain", + "pset_firesuppressionterminaltypefirehydrant": "ifcplumbingfireprotectiondomain", + "pset_firesuppressionterminaltypehosereel": "ifcplumbingfireprotectiondomain", + "pset_firesuppressionterminaltypesprinkler": "ifcplumbingfireprotectiondomain", + "pset_flowinstrumentphistory": "ifcbuildingcontrolsdomain", + "pset_flowinstrumenttypecommon": "ifcbuildingcontrolsdomain", + "pset_flowinstrumenttypepressuregauge": "ifcbuildingcontrolsdomain", + "pset_flowinstrumenttypethermometer": "ifcbuildingcontrolsdomain", + "pset_flowmeteroccurrence": "ifchvacdomain", + "pset_flowmetertypecommon": "ifchvacdomain", + "pset_flowmetertypeenergymeter": "ifchvacdomain", + "pset_flowmetertypegasmeter": "ifchvacdomain", + "pset_flowmetertypeoilmeter": "ifchvacdomain", + "pset_flowmetertypewatermeter": "ifchvacdomain", + "pset_footingcommon": "ifcstructuralelementsdomain", + "pset_furnituretypechair": "ifcsharedfacilitieselements", + "pset_furnituretypecommon": "ifcsharedfacilitieselements", + "pset_furnituretypedesk": "ifcsharedfacilitieselements", + "pset_furnituretypefilecabinet": "ifcsharedfacilitieselements", + "pset_furnituretypetable": "ifcsharedfacilitieselements", + "pset_heatexchangertypecommon": "ifchvacdomain", + "pset_heatexchangertypeplate": "ifchvacdomain", + "pset_humidifierphistory": "ifchvacdomain", + "pset_humidifiertypecommon": "ifchvacdomain", + "pset_interceptortypecommon": "ifcplumbingfireprotectiondomain", + "pset_junctionboxtypecommon": "ifcelectricaldomain", + "pset_lamptypecommon": "ifcelectricaldomain", + "pset_landregistration": "ifcproductextension", + "pset_lightfixturetypecommon": "ifcelectricaldomain", + "pset_lightfixturetypesecuritylighting": "ifcelectricaldomain", + "pset_manufactureroccurrence": "ifcsharedfacilitieselements", + "pset_manufacturertypeinformation": "ifcsharedfacilitieselements", + "pset_materialcombustion": "ifcmaterialresource", + "pset_materialcommon": "ifcmaterialresource", + "pset_materialconcrete": "ifcmaterialresource", + "pset_materialenergy": "ifcmaterialresource", + "pset_materialfuel": "ifcmaterialresource", + "pset_materialhygroscopic": "ifcmaterialresource", + "pset_materialmechanical": "ifcmaterialresource", + "pset_materialoptical": "ifcmaterialresource", + "pset_materialsteel": "ifcmaterialresource", + "pset_materialthermal": "ifcmaterialresource", + "pset_materialwater": "ifcmaterialresource", + "pset_materialwood": "ifcmaterialresource", + "pset_materialwoodbasedbeam": "ifcmaterialresource", + "pset_materialwoodbasedpanel": "ifcmaterialresource", + "pset_mechanicalfasteneranchorbolt": "ifcsharedcomponentelements", + "pset_mechanicalfastenerbolt": "ifcsharedcomponentelements", + "pset_mechanicalfastenercommon": "ifcsharedcomponentelements", + "pset_medicaldevicetypecommon": "ifchvacdomain", + "pset_membercommon": "ifcsharedbldgelements", + "pset_motorconnectiontypecommon": "ifcelectricaldomain", + "pset_openingelementcommon": "ifcproductextension", + "pset_outlettypecommon": "ifcelectricaldomain", + "pset_outsidedesigncriteria": "ifcsharedbldgserviceelements", + "pset_packinginstructions": "ifcsharedmgmtelements", + "pset_permit": "ifcsharedmgmtelements", + "pset_pilecommon": "ifcstructuralelementsdomain", + "pset_pipeconnectionflanged": "ifchvacdomain", + "pset_pipefittingoccurrence": "ifchvacdomain", + "pset_pipefittingphistory": "ifchvacdomain", + "pset_pipefittingtypebend": "ifchvacdomain", + "pset_pipefittingtypecommon": "ifchvacdomain", + "pset_pipefittingtypejunction": "ifchvacdomain", + "pset_pipesegmentoccurrence": "ifchvacdomain", + "pset_pipesegmentphistory": "ifchvacdomain", + "pset_pipesegmenttypecommon": "ifchvacdomain", + "pset_pipesegmenttypeculvert": "ifchvacdomain", + "pset_pipesegmenttypegutter": "ifchvacdomain", + "pset_platecommon": "ifcsharedbldgelements", + "pset_precastconcreteelementfabrication": "ifcstructuralelementsdomain", + "pset_precastconcreteelementgeneral": "ifcstructuralelementsdomain", + "pset_precastslab": "ifcstructuralelementsdomain", + "pset_profilearbitrarydoublet": "ifcprofileresource", + "pset_profilearbitraryhollowcore": "ifcprofileresource", + "pset_profilemechanical": "ifcprofileresource", + "pset_projectorderchangeorder": "ifcsharedmgmtelements", + "pset_projectordermaintenanceworkorder": "ifcsharedmgmtelements", + "pset_projectordermoveorder": "ifcsharedmgmtelements", + "pset_projectorderpurchaseorder": "ifcsharedmgmtelements", + "pset_projectorderworkorder": "ifcsharedmgmtelements", + "pset_propertyagreement": "ifcsharedfacilitieselements", + "pset_protectivedevicebreakeruniti2tcurve": "ifcelectricaldomain", + "pset_protectivedevicebreakeruniti2tfusecurve": "ifcelectricaldomain", + "pset_protectivedevicebreakerunitipicurve": "ifcelectricaldomain", + "pset_protectivedevicebreakerunittypemcb": "ifcelectricaldomain", + "pset_protectivedevicebreakerunittypemotorprotection": "ifcelectricaldomain", + "pset_protectivedeviceoccurrence": "ifcelectricaldomain", + "pset_protectivedevicetrippingcurve": "ifcelectricaldomain", + "pset_protectivedevicetrippingfunctiongcurve": "ifcelectricaldomain", + "pset_protectivedevicetrippingfunctionicurve": "ifcelectricaldomain", + "pset_protectivedevicetrippingfunctionlcurve": "ifcelectricaldomain", + "pset_protectivedevicetrippingfunctionscurve": "ifcelectricaldomain", + "pset_protectivedevicetrippingunitcurrentadjustment": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittimeadjustment": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittypecommon": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittypeelectromagnetic": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittypeelectronic": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittyperesidualcurrent": "ifcelectricaldomain", + "pset_protectivedevicetrippingunittypethermal": "ifcelectricaldomain", + "pset_protectivedevicetypecircuitbreaker": "ifcelectricaldomain", + "pset_protectivedevicetypecommon": "ifcelectricaldomain", + "pset_protectivedevicetypeearthleakagecircuitbreaker": "ifcelectricaldomain", + "pset_protectivedevicetypefusedisconnector": "ifcelectricaldomain", + "pset_protectivedevicetyperesidualcurrentcircuitbreaker": "ifcelectricaldomain", + "pset_protectivedevicetyperesidualcurrentswitch": "ifcelectricaldomain", + "pset_protectivedevicetypevaristor": "ifcelectricaldomain", + "pset_pumpoccurrence": "ifchvacdomain", + "pset_pumpphistory": "ifchvacdomain", + "pset_pumptypecommon": "ifchvacdomain", + "pset_railingcommon": "ifcsharedbldgelements", + "pset_rampcommon": "ifcsharedbldgelements", + "pset_rampflightcommon": "ifcsharedbldgelements", + "pset_reinforcementbarcountofindependentfooting": "ifcstructuralelementsdomain", + "pset_reinforcementbarpitchofbeam": "ifcstructuralelementsdomain", + "pset_reinforcementbarpitchofcolumn": "ifcstructuralelementsdomain", + "pset_reinforcementbarpitchofcontinuousfooting": "ifcstructuralelementsdomain", + "pset_reinforcementbarpitchofslab": "ifcstructuralelementsdomain", + "pset_reinforcementbarpitchofwall": "ifcstructuralelementsdomain", + "pset_reinforcingbarcommon": "ifcstructuralelementsdomain", + "pset_reinforcingmeshcommon": "ifcstructuralelementsdomain", + "pset_risk": "ifcsharedfacilitieselements", + "pset_roofcommon": "ifcsharedbldgelements", + "pset_sanitaryterminaltypebath": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypebidet": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypecistern": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypecommon": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypesanitaryfountain": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypeshower": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypesink": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypetoiletpan": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypeurinal": "ifcplumbingfireprotectiondomain", + "pset_sanitaryterminaltypewashhandbasin": "ifcplumbingfireprotectiondomain", + "pset_sensorphistory": "ifcbuildingcontrolsdomain", + "pset_sensortypeco2sensor": "ifcbuildingcontrolsdomain", + "pset_sensortypecommon": "ifcbuildingcontrolsdomain", + "pset_sensortypeconductancesensor": "ifcbuildingcontrolsdomain", + "pset_sensortypecontactsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypefiresensor": "ifcbuildingcontrolsdomain", + "pset_sensortypeflowsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypefrostsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypegassensor": "ifcbuildingcontrolsdomain", + "pset_sensortypeheatsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypehumiditysensor": "ifcbuildingcontrolsdomain", + "pset_sensortypeidentifiersensor": "ifcbuildingcontrolsdomain", + "pset_sensortypeionconcentrationsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypelevelsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypelightsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypemoisturesensor": "ifcbuildingcontrolsdomain", + "pset_sensortypemovementsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypephsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypepressuresensor": "ifcbuildingcontrolsdomain", + "pset_sensortyperadiationsensor": "ifcbuildingcontrolsdomain", + "pset_sensortyperadioactivitysensor": "ifcbuildingcontrolsdomain", + "pset_sensortypesmokesensor": "ifcbuildingcontrolsdomain", + "pset_sensortypesoundsensor": "ifcbuildingcontrolsdomain", + "pset_sensortypetemperaturesensor": "ifcbuildingcontrolsdomain", + "pset_sensortypewindsensor": "ifcbuildingcontrolsdomain", + "pset_servicelife": "ifcsharedfacilitieselements", + "pset_servicelifefactors": "ifcsharedfacilitieselements", + "pset_shadingdevicecommon": "ifcsharedbldgelements", + "pset_shadingdevicephistory": "ifchvacdomain", + "pset_sitecommon": "ifcproductextension", + "pset_slabcommon": "ifcsharedbldgelements", + "pset_solardevicetypecommon": "ifcelectricaldomain", + "pset_soundattenuation": "ifcsharedbldgserviceelements", + "pset_soundgeneration": "ifcsharedbldgserviceelements", + "pset_spacecommon": "ifcproductextension", + "pset_spacecoveringrequirements": "ifcproductextension", + "pset_spacefiresafetyrequirements": "ifcproductextension", + "pset_spaceheaterphistory": "ifchvacdomain", + "pset_spaceheatertypecommon": "ifchvacdomain", + "pset_spaceheatertypeconvector": "ifchvacdomain", + "pset_spaceheatertyperadiator": "ifchvacdomain", + "pset_spacelightingrequirements": "ifcproductextension", + "pset_spaceoccupancyrequirements": "ifcproductextension", + "pset_spaceparking": "ifcproductextension", + "pset_spacethermaldesign": "ifcsharedbldgserviceelements", + "pset_spacethermalload": "ifcsharedbldgserviceelements", + "pset_spacethermalloadphistory": "ifcsharedbldgserviceelements", + "pset_spacethermalphistory": "ifchvacdomain", + "pset_spacethermalrequirements": "ifcproductextension", + "pset_spatialzonecommon": "ifcproductextension", + "pset_stackterminaltypecommon": "ifcplumbingfireprotectiondomain", + "pset_staircommon": "ifcsharedbldgelements", + "pset_stairflightcommon": "ifcsharedbldgelements", + "pset_structuralsurfacemembervaryingthickness": "ifcstructuralanalysisdomain", + "pset_switchingdevicetypecommon": "ifcelectricaldomain", + "pset_switchingdevicetypecontactor": "ifcelectricaldomain", + "pset_switchingdevicetypedimmerswitch": "ifcelectricaldomain", + "pset_switchingdevicetypeemergencystop": "ifcelectricaldomain", + "pset_switchingdevicetypekeypad": "ifcelectricaldomain", + "pset_switchingdevicetypemomentaryswitch": "ifcelectricaldomain", + "pset_switchingdevicetypephistory": "ifcelectricaldomain", + "pset_switchingdevicetypeselectorswitch": "ifcelectricaldomain", + "pset_switchingdevicetypestarter": "ifcelectricaldomain", + "pset_switchingdevicetypeswitchdisconnector": "ifcelectricaldomain", + "pset_switchingdevicetypetoggleswitch": "ifcelectricaldomain", + "pset_systemfurnitureelementtypecommon": "ifcsharedfacilitieselements", + "pset_systemfurnitureelementtypepanel": "ifcsharedfacilitieselements", + "pset_systemfurnitureelementtypeworksurface": "ifcsharedfacilitieselements", + "pset_tankoccurrence": "ifchvacdomain", + "pset_tankphistory": "ifchvacdomain", + "pset_tanktypecommon": "ifchvacdomain", + "pset_tanktypeexpansion": "ifchvacdomain", + "pset_tanktypepreformed": "ifchvacdomain", + "pset_tanktypepressurevessel": "ifchvacdomain", + "pset_tanktypesectional": "ifchvacdomain", + "pset_tendonanchorcommon": "ifcstructuralelementsdomain", + "pset_tendoncommon": "ifcstructuralelementsdomain", + "pset_thermalloadaggregate": "ifcsharedbldgserviceelements", + "pset_thermalloaddesigncriteria": "ifcsharedbldgserviceelements", + "pset_transformertypecommon": "ifcelectricaldomain", + "pset_transportelementcommon": "ifcproductextension", + "pset_transportelementelevator": "ifcproductextension", + "pset_tubebundletypecommon": "ifchvacdomain", + "pset_tubebundletypefinned": "ifchvacdomain", + "pset_unitarycontrolelementphistory": "ifcbuildingcontrolsdomain", + "pset_unitarycontrolelementtypecommon": "ifcbuildingcontrolsdomain", + "pset_unitarycontrolelementtypeindicatorpanel": "ifcbuildingcontrolsdomain", + "pset_unitarycontrolelementtypethermostat": "ifcbuildingcontrolsdomain", + "pset_unitaryequipmenttypeairconditioningunit": "ifchvacdomain", + "pset_unitaryequipmenttypeairhandler": "ifchvacdomain", + "pset_unitaryequipmenttypecommon": "ifchvacdomain", + "pset_utilityconsumptionphistory": "ifcsharedbldgserviceelements", + "pset_valvephistory": "ifchvacdomain", + "pset_valvetypeairrelease": "ifchvacdomain", + "pset_valvetypecommon": "ifchvacdomain", + "pset_valvetypedrawoffcock": "ifchvacdomain", + "pset_valvetypefaucet": "ifchvacdomain", + "pset_valvetypeflushing": "ifchvacdomain", + "pset_valvetypegastap": "ifchvacdomain", + "pset_valvetypeisolating": "ifchvacdomain", + "pset_valvetypemixing": "ifchvacdomain", + "pset_valvetypepressurereducing": "ifchvacdomain", + "pset_valvetypepressurerelief": "ifchvacdomain", + "pset_vibrationisolatortypecommon": "ifchvacdomain", + "pset_wallcommon": "ifcsharedbldgelements", + "pset_warranty": "ifcsharedfacilitieselements", + "pset_wasteterminaltypecommon": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypefloortrap": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypefloorwaste": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypegullysump": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypegullytrap": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltyperoofdrain": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypewastedisposalunit": "ifcplumbingfireprotectiondomain", + "pset_wasteterminaltypewastetrap": "ifcplumbingfireprotectiondomain", + "pset_windowcommon": "ifcsharedbldgelements", + "pset_workcontrolcommon": "ifcprocessextension", + "pset_zonecommon": "ifcproductextension", + "qto_actuatorbasequantities": "ifcbuildingcontrolsdomain", + "qto_airterminalbasequantities": "ifchvacdomain", + "qto_airterminalboxtypebasequantities": "ifchvacdomain", + "qto_airtoairheatrecoverybasequantities": "ifchvacdomain", + "qto_alarmbasequantities": "ifcbuildingcontrolsdomain", + "qto_audiovisualappliancebasequantities": "ifcelectricaldomain", + "qto_beambasequantities": "ifcsharedbldgelements", + "qto_boilerbasequantities": "ifchvacdomain", + "qto_buildingbasequantities": "ifcproductextension", + "qto_buildingelementproxyquantities": "ifcsharedbldgelements", + "qto_buildingstoreybasequantities": "ifcproductextension", + "qto_burnerbasequantities": "ifchvacdomain", + "qto_cablecarrierfittingbasequantities": "ifcelectricaldomain", + "qto_cablecarriersegmentbasequantities": "ifcelectricaldomain", + "qto_cablefittingbasequantities": "ifcelectricaldomain", + "qto_cablesegmentbasequantities": "ifcelectricaldomain", + "qto_chillerbasequantities": "ifchvacdomain", + "qto_chimneybasequantities": "ifcsharedbldgelements", + "qto_coilbasequantities": "ifchvacdomain", + "qto_columnbasequantities": "ifcsharedbldgelements", + "qto_communicationsappliancebasequantities": "ifcelectricaldomain", + "qto_compressorbasequantities": "ifchvacdomain", + "qto_condenserbasequantities": "ifchvacdomain", + "qto_constructionequipmentresourcebasequantities": "ifcconstructionmgmtdomain", + "qto_constructionmaterialresourcebasequantities": "ifcconstructionmgmtdomain", + "qto_controllerbasequantities": "ifcbuildingcontrolsdomain", + "qto_cooledbeambasequantities": "ifchvacdomain", + "qto_coolingtowerbasequantities": "ifchvacdomain", + "qto_coveringbasequantities": "ifcsharedbldgelements", + "qto_curtainwallquantities": "ifcsharedbldgelements", + "qto_damperbasequantities": "ifchvacdomain", + "qto_distributionchamberelementbasequantities": "ifcsharedbldgserviceelements", + "qto_doorbasequantities": "ifcsharedbldgelements", + "qto_ductfittingbasequantities": "ifchvacdomain", + "qto_ductsegmentbasequantities": "ifchvacdomain", + "qto_ductsilencerbasequantities": "ifchvacdomain", + "qto_electricappliancebasequantities": "ifcelectricaldomain", + "qto_electricdistributionboardbasequantities": "ifcelectricaldomain", + "qto_electricflowstoragedevicebasequantities": "ifcelectricaldomain", + "qto_electricgeneratorbasequantities": "ifcelectricaldomain", + "qto_electricmotorbasequantities": "ifcelectricaldomain", + "qto_electrictimecontrolbasequantities": "ifcelectricaldomain", + "qto_evaporativecoolerbasequantities": "ifchvacdomain", + "qto_evaporatorbasequantities": "ifchvacdomain", + "qto_fanbasequantities": "ifchvacdomain", + "qto_filterbasequantities": "ifchvacdomain", + "qto_firesuppressionterminalbasequantities": "ifcplumbingfireprotectiondomain", + "qto_flowinstrumentbasequantities": "ifcbuildingcontrolsdomain", + "qto_flowmeterbasequantities": "ifchvacdomain", + "qto_footingbasequantities": "ifcstructuralelementsdomain", + "qto_heatexchangerbasequantities": "ifchvacdomain", + "qto_humidifierbasequantities": "ifchvacdomain", + "qto_interceptorbasequantities": "ifcplumbingfireprotectiondomain", + "qto_junctionboxbasequantities": "ifcelectricaldomain", + "qto_laborresourcebasequantities": "ifcconstructionmgmtdomain", + "qto_lampbasequantities": "ifcelectricaldomain", + "qto_lightfixturebasequantities": "ifcelectricaldomain", + "qto_memberbasequantities": "ifcsharedbldgelements", + "qto_motorconnectionbasequantities": "ifcelectricaldomain", + "qto_openingelementbasequantities": "ifcproductextension", + "qto_outletbasequantities": "ifcelectricaldomain", + "qto_pilebasequantities": "ifcstructuralelementsdomain", + "qto_pipefittingbasequantities": "ifchvacdomain", + "qto_pipesegmentbasequantities": "ifchvacdomain", + "qto_platebasequantities": "ifcsharedbldgelements", + "qto_projectionelementbasequantities": "ifcproductextension", + "qto_protectivedevicebasequantities": "ifcelectricaldomain", + "qto_protectivedevicetrippingunitbasequantities": "ifcelectricaldomain", + "qto_pumpbasequantities": "ifchvacdomain", + "qto_railingbasequantities": "ifcsharedbldgelements", + "qto_rampflightbasequantities": "ifcsharedbldgelements", + "qto_reinforcingelementbasequantities": "ifcstructuralelementsdomain", + "qto_roofbasequantities": "ifcsharedbldgelements", + "qto_sanitaryterminalbasequantities": "ifcplumbingfireprotectiondomain", + "qto_sensorbasequantities": "ifcbuildingcontrolsdomain", + "qto_sitebasequantities": "ifcproductextension", + "qto_slabbasequantities": "ifcsharedbldgelements", + "qto_solardevicebasequantities": "ifcelectricaldomain", + "qto_spacebasequantities": "ifcproductextension", + "qto_spaceheaterbasequantities": "ifchvacdomain", + "qto_stackterminalbasequantities": "ifcplumbingfireprotectiondomain", + "qto_stairflightbasequantities": "ifcsharedbldgelements", + "qto_switchingdevicebasequantities": "ifcelectricaldomain", + "qto_tankbasequantities": "ifchvacdomain", + "qto_transformerbasequantities": "ifcelectricaldomain", + "qto_tubebundlebasequantities": "ifchvacdomain", + "qto_unitarycontrolelementbasequantities": "ifcbuildingcontrolsdomain", + "qto_unitaryequipmentbasequantities": "ifchvacdomain", + "qto_valvebasequantities": "ifchvacdomain", + "qto_vibrationisolatorbasequantities": "ifchvacdomain", + "qto_wallbasequantities": "ifcsharedbldgelements", + "qto_wasteterminalbasequantities": "ifcplumbingfireprotectiondomain", + "qto_windowbasequantities": "ifcsharedbldgelements" +} \ No newline at end of file